KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102114672
Entry
102114672         CDS       T02921                                 

Gene name
HHIP
Definition
(RefSeq) hedgehog interacting protein
  KO
K06231  hedgehog interacting protein
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102114672 (HHIP)
SSDB
Motif
Pfam: Folate_rec GSDH EGF_2
Other DBs
NCBI-GeneID: 102114672
NCBI-ProteinID: XP_005525664
LinkDB
Position
Un
AA seq 696 aa
MLKMLPFKLLLVAVVLCFFEGDAKFGESGARRRRCLNGTPPRRLKKRDRRVLSPEAPGGG
EAMCRGLYPRLSCCSRSEAQGLPHGEAKVLSVTNNTECGKLLEEIKCAHCSPHAQNLFHS
PEKGETPEKELMLPYLCKDYCKEFYYTCRGHIPGFLQTTADEFCYYYARKDGGVCFPDFP
RKQVRGPASNSLDHMEEYDKEEEISRKHKHNCFCIQEVVSGLRQPVGAVHCGDGSHRLFI
LEKEGYVKIFTPEGDILKEPFLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYT
TNQERWAIGPHDHILRVVEYTVSRKNPHQVDMRTARVFLEVAELHRKHLGGQLLFGPDGF
LYIFLGDGMITLDDMEEMDGLSDFTGSVLRLDVNTDLCNVPYSIPRSNPHFNSTNQPPEI
FAHGLHNPGRCAVDRHPTDVNINLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFK
PFSSGSLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPATKQWQEKPLCLGNTGSCR
GFFSGPVLGFGEDELGEIYILSSSKSMTQPHSGKLYKIVDPKRPLVPEECKRTAQPAQIL
TSECSRHCRNGHCTPTGKCCCNQGWEGEFCRTAKCDPACRHGGVCVRPNKCLCKKGYLGP
QCEQVDRNIRRVTRAGILDQILDMTSYLLDLTSYIV
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgctcaagatgctgccgtttaagctgctgctggtggccgtggttctgtgcttcttcgag
ggggatgccaagtttggggagagcggcgcccggaggagaaggtgcctcaacgggaccccg
ccgcggcggctgaagaagcgggaccggcgggtgctgtccccggaggccccgggcggcggg
gaggcgatgtgccgcggcctctacccccgcctgtcctgctgttcccgctccgaggcgcag
ggactgccgcacggcgaggccaaggtcctttctgttaccaacaacacagaatgtggaaag
ctactggaggaaatcaagtgtgcacactgctcaccacatgctcagaacctattccactca
cctgagaaaggggaaactcctgaaaaagaactaatgcttccctacctgtgcaaagactat
tgtaaagaattctattacacctgcagaggtcatataccaggtttcctccaaactacagct
gatgagttttgctattactatgcaagaaaagatggtggtgtgtgctttccagattttcca
agaaaacaagtgcgagggccggcttctaactccctggaccacatggaagaatatgacaaa
gaggaagagatcagcagaaaacacaagcacaactgcttctgtattcaggaggttgtgagc
ggactaaggcaacctgttggagcagtacattgtggggatggatcccatcgcctctttatt
cttgagaaagaaggatacgtgaagatttttactccggaaggagacatactcaaggagcct
tttttggatatacacaagcttgttcaaagtggaataaagggaggagatgaaagaggactg
ttaagccttgcattccaccccaattacaagaaaaatggaaagctgtacgtgtcttatacc
accaaccaagaacggtgggctattggacctcatgaccacatccttagggtcgtggagtac
acagtatccaggaaaaatccacaccaagttgacatgaggacagcaagagtgtttttagaa
gtagcagaactacatcgaaaacatctaggaggacagctgttgtttggcccagatggtttc
ctgtacatttttcttggagatggcatgatcactctagatgacatggaggagatggatggt
ttaagtgattttacaggttctgtactgcgcctcgatgtcaatactgacctgtgcaatgtg
ccttattccatcccacggagcaacccacacttcaatagcacaaaccaacctcctgagatt
tttgcacatggactccacaatccaggccggtgtgctgtggaccggcacccaacagatgta
aacatcaatttaactatactttgttcagattcaaatggaaagaacagatcttcagcaagg
atcttacaaataataaagggcaaagactatgagagtgagccctcacttctagaattcaaa
ccgtttagcagtgggtccctggttggtggatttgtgtatcggggctgccagtcggagagg
ctctatggaagttatgtgtttggagaccgcaatggaaattttttaacactgcaacagagt
cctgcaaccaaacagtggcaagagaaacccctctgtcttggcaacaccggctcatgtaga
ggtttcttttcaggccctgtcttgggatttggagaagatgaattaggtgagatttacata
ttatcaagcagtaaaagtatgacacagcctcacagtggaaaactctacaagattgttgac
ccaaaaaggcctttagtccctgaagaatgcaaaagaacagctcagcctgcacagatactg
acatctgaatgctcaaggcattgtcggaacgggcactgcactcccacaggaaaatgctgc
tgtaatcaaggctgggaaggagagttctgcagaactgcaaaatgtgacccagcctgtcga
catggaggtgtctgtgtaaggcccaataaatgcttatgtaaaaaaggctatctgggcccc
cagtgtgaacaagtggatagaaacatccgaagagtgacaagggcaggtattcttgatcag
atcctagacatgacatcttatttgctggatctaaccagctatattgtatag

DBGET integrated database retrieval system