KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102114734Help
Entry
102114734         CDS       T02921                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:phi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102114734 (SETD1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phi03036]
    102114734 (SETD1B)
Enzymes [BR:phi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102114734 (SETD1B)
Chromosome and associated proteins [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102114734 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     102114734 (SETD1B)
    COMPASS/SET1 complex (yeast)
     102114734 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 102114734
NCBI-ProteinID: XP_014109409
LinkDB All DBs
Position
Un
AA seq 2027 aa AA seqDB search
MSFRETKAGEKAKHPEDHGKKQSSSWINGMENSTQASTSVEKRNHHWRSYKLIIDPALKK
GQHKLYRYDGQHFSMPNSGIAPVDCVRDPRIGRIWTKTKELELSVPKFKIDEFYVGPVPP
KQVTFAKLNDNIRENFLADMCKKYGEVEEVEILYNPKNKKHLGIAKVIFATVKGAREAVQ
HLHNTSVMGNIIHVELDTKGETRMRFYELLVNGLYTPQTLPVGTEQDVSPTGNEALQLTD
SLKRLKDSSLSSAGSSVTPNSSTPFSHDTAYSSCRQDTPNSYSQFTPQSQGTPHTPRLGT
PFSQDSTYSSRQTTPVYHFGQDSGYKPRRHETKFTDAYNRRPGHHYLHNSAGVFRGTEHQ
FSTFKSHQQEPVQFSHTPPLSHSSSSSYKSAFSPYQAPAVFPQSDEQPFPQTSRETEYRR
PAPPPTEMVVESSAAPSIDFVPVKEKPEEPPPLPDSNSVPEPSTASFSQTPERSETPGTP
TMESEMQHNSLDSRIEMLLKEQRTKLPFLNEHDSDNEIRMEGSPISSSSSQLSPIPTYGS
NSQPGFRGQTPSSRPSSTGLEDISPTPLPDSDDDEPIPGTASLSQNSRGTSEASMTPIDQ
LSRTSKIETLEAKEMVPGDQTPTSEKMDEGQHSSGEDMEISDDETNPAPITSAECAKTIV
VNSSVSNTAVLAPSIPPLPPPGFPPLPPPPPPQPGFPMPPPLPPPPPPTHPAVTVPPPPL
PAPPGVPPPHILPPLPPFHPGMFPVMQVDMISVLGNQWGGMPMSFQMQTQMLSRMMQAQN
TYQYPPFVTGRMQFVNLPPYRPFSMGAALARGQQWPPLPKFDPSVPPPGYEPKKEDPHKA
TVDGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDDWWDKKERLAKASLTPVKSGGELEE
KPKPKDRIASCLLENWNKGEGLGYEAIGLGIGLRGAIRLPSFKVKRKEPPEAASAGDQKR
IRPSTSVDDEDEESERDRDASDTTSELSKKDAEAVGLRRRPARPLELDSEGEEGDETSGK
EEESSSEKEEEQEEEGGLVKAAPGKEEEEDEEDEDDEDEDDDEDEDEDDEEETGIDTSDK
EEEQDSEEGKQLHWKQRVSPSGQLWSPFFFYVASPSSSKAEVESSDESEDSSEFESSSDS
DDEDEEDDDDDEDEEEEEEEEVAEDQSREAMVAEPEHEPAGLELPDDERETILDLYPVDD
YMDATGLGLAEPALAVKDEGSGEIKAGESECGQVPGASIAAETLKHLVMERDQETKLALS
PICRPEEESEPTSMLEPEVQEGPKPESQDEEAALCISTPVAVFGEPLPSKSSFFGKSEES
SLEARVKAKPPSAAEEDERLPRTPGREVMTHSETETLLLPAHKVPSSMLPLPSTPGKEES
LVPPEKFPEQLLVTKTSVEEEIPRTPGRDILAKSSHPLAKSQSTDTVPATPGSDAPLTGS
SLTLSSPQVPGSPFSYPSQSPGINSGIPRTPGRDFNFTPTFPEAGATIPCLLPGKKQSED
ELEEKPFKEPLGASLTISMNSVPSPIPFASPPQADFHMDMGLPPDEPIPVAALPCMHGDG
RMPIEECKAEVKPGLLSPEVPPGASILPPPPPPSVLPKRRPGRPRRSPPSVLSLDVYSGK
TIEPPPMPVALVEGPVGKELLSGHPDAYYGLKDPEAVTLDFRNDGFHEKIAAETVAEKLP
FKELENQWNEDLKEEEAHAKPKRQWRRQKKTSEELPMIPSPEYSPPQPQFRPRSEFEEMT
ILYDIWNGGIDEEDIKFMCITYDRLLQQDNGMDWLNDTLWVFHPSTSFSTPKKKKRDDGM
REHVTGCARSEGYYKIDKKDKLKYLNNSRAFAEEPPADTQGMSIPAQPHASTRAGSERRS
EQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQ
NIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITV
ESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 6084 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccgagagaccaaggcgggggaaaaagccaagcaccctgaagatcatggcaaa
aagcagagttcaagttggatcaacggaatggagaacagcacgcaagccagcacttctgtc
gagaaaagaaatcaccattggagaagttacaagttgattattgacccggctctgaaaaaa
ggacagcacaaactctaccgttacgatgggcaacatttcagcatgcctaactcggggatc
gctcctgtggactgtgtcagggatcccagaatagggcgaatatggaccaaaactaaggag
ttggagctgtctgtccccaaattcaagattgatgaattttacgtggggccagtgcctccc
aagcaggtcacttttgccaagctgaatgacaacatccgtgaaaactttttggccgacatg
tgcaagaagtacggcgaagtggaagaggtggaaattctatacaaccccaagaacaagaag
cacctgggcattgccaaagtcatctttgccactgtcaagggtgcccgggaggctgtgcag
caccttcacaacacctctgtcatgggcaacatcatccacgtggagctggatacaaaaggt
gaaacccgcatgagattctatgaactgctggttaatggtctttacactcctcagaccctc
cctgtaggcactgaacaggatgtgtccccaactgggaatgaagctctccagttgacggac
tccctgaagcgcttgaaggacagttccctgtcttccgcgggatcctccgttaccccaaac
agcagcacgcccttttcccacgacacagcctattccagctgtcggcaagacaccccaaac
tcctacagccaattcaccccacagtcccaaggaacaccccacaccccacgcctggggaca
ccgttctcccaggattccacctactccagccgacagacaacgcctgtgtaccattttggg
caggacagtgggtacaaacccaggaggcacgagacgaaatttacggatgcgtacaaccgt
cgcccgggacaccactacctgcacaactcggcgggggtgttccgaggcacagagcatcag
tttagcacattcaaatcccatcagcaggagccagttcagttctctcacactcctcccctg
agccactctagttcttcgagctataaatccgccttctccccctaccaagcaccagctgtt
tttccccaatctgatgaacagccgtttccccaaacttccagggagacagagtaccggaga
cctgcaccgcctcccaccgagatggttgtggaaagcagcgctgccccgagcatcgatttt
gtcccagtgaaggagaaaccagaggagcctccgcccttgcccgactcaaactctgttcct
gaaccgagcacagcatccttctctcagactccagagaggagtgagacccctggcaccccc
accatggagtctgagatgcagcataacagtttagactcaaggattgagatgctcttaaaa
gagcagagaacaaaattaccttttcttaacgagcatgactcagataatgagatccgaatg
gaaggtagccctatttcctcctcttcttcccagctctcccccatcccaacatacggttcg
aactctcagcctggtttcaggggtcagacgccttcctcacgcccttccagcacaggtttg
gaggacatcagccccacacccttacctgactctgatgatgacgagcccatccctgggaca
gcttctctgagtcagaattcccggggaacatcggaggccagcatgactcccattgatcag
ctgagcaggacctccaaaattgaaaccctggaggctaaagaaatggtacctggtgaccag
actccaacatcagaaaaaatggacgagggtcagcattcctcaggggaggacatggaaatc
tccgacgacgagaccaaccctgcgcccatcaccagcgcggaatgtgccaaaaccattgtg
gtgaactcctccgtcagcaacacggccgtgctggccccgtccatcccccccctgccacca
ccgggattccctcctcttcctcctccgccgcccccgcagcccggcttccccatgcccccg
ccgctgcctccaccgccgccgcccacgcacccggccgtcaccgtgcccccgccgccgctg
cccgccccgcccggggtccctccacctcacatcctgcccccgctgccccccttccatccc
ggcatgttcccggtcatgcaggtggatatgatcagtgtcttgggcaaccagtggggtggc
atgccgatgtccttccagatgcaaactcagatgctgagccgcatgatgcaggcgcagaac
acgtaccagtacccgcctttcgtgacgggtcggatgcagtttgtgaatcttcctccctac
cgcccgttctcgatgggagccgctctcgcccgcgggcagcagtggccaccgctgcccaag
tttgacccctcggttccgcccccgggttatgagccgaagaaggaagatccccacaaagcc
actgtggatggagtcctcctggtcatagtgaaggaactaaaggccatcatgaaaagggac
ctgaaccgcaagatggtcgaagtggtggcgttccgggcgtttgatgactggtgggacaag
aaggaacgtcttgcaaaagcgtctctcactccagtgaagtctggaggagaactggaggaa
aaaccaaagccaaaggatcgaattgcctcttgtcttctggagaactggaacaaaggagaa
gggctgggatatgaggcaatcggcttgggcattgggttacgaggggccatccggctgcca
tccttcaaggtgaaaagaaaggagccacctgaagctgcctcagcgggagatcagaagaga
atccggccttctacttctgtggatgatgaagatgaagagtctgagagggacagggatgct
tctgatacaacatctgagctgtcaaagaaggatgcagaggcagtggggctgcgacggcga
ccagcaaggccgttggagctcgacagcgagggagaagaaggagatgagacatcagggaaa
gaggaagagtcctcctcagagaaggaagaggagcaggaagaagagggaggcttggtgaaa
gcagcacctggcaaggaggaagaggaggatgaggaggatgaagatgatgaggatgaagat
gatgatgaagacgaggatgaagatgatgaggaggagacaggcatagatacaagtgacaag
gaggaggagcaggactccgaggagggtaagcagctccactggaagcagcgagtgtcaccc
tcgggtcagctgtggtctcccttcttcttttatgtagcaagtccctcatcttccaaggct
gaagttgaatcatctgatgaaagtgaggactcctctgaatttgagtcaagttcagactcg
gatgatgaagatgaggaggacgatgatgacgatgaagatgaggaggaggaagaggaggaa
gaggtggctgaagatcaaagcagagaagccatggttgctgagccagagcatgaacctgct
ggtcttgagcttcctgatgatgagagggagactattttggacctgtatcctgtggatgac
tacatggatgcaacaggcttgggacttgctgagccagctttggctgtgaaagatgaaggc
agtggagaaatcaaggcaggggaaagtgagtgcggccaagtcccgggggcttctattgct
gctgaaactctgaaacacttggttatggaaagagaccaggagacaaaacttgcactctct
cccatctgtaggccagaggaggagtccgaacccacttccatgctggagccggaggtacag
gaaggtccaaagcctgaatctcaagatgaggaagcagctctctgtatctctactccagtg
gcagtctttggagaacctctgcccagcaaaagcagcttctttggcaagtctgaggagagc
agcttggaagcccgagttaaagcaaagccaccgtcggcagcagaggaggacgagcggctg
ccccgcacgcctggacgggaggtgatgacccactcggagactgagactctcctgcttcca
gcccacaaggtgccatcctccatgcttcccttgccatcgacacccggcaaggaagaatct
ttagtccctccagaaaagttccctgaacaattactggtgaccaaaacgtccgtggaagag
gagattcctaggactcccgggcgggacattttggccaagtcttcacaccccctcgcgaag
tcgcagagcacggacactgttccagccacgccaggaagtgatgctccccttacaggaagc
agcttgaccctcagttcccctcaagtcccagggagccccttttcctacccatcccaatct
cctggcattaacagtggcattcctcggactcctgggagagatttcaatttcacgcctact
ttcccagaggctggtgctaccattccttgccttctgcctggcaagaaacagtcagaggat
gagctagaagagaaaccctttaaagagcctcttggtgcttcccttacgatcagcatgaac
agtgttccttcccctatcccctttgccagccccccacaggcagatttccacatggacatg
ggtttgccacctgatgagccaatacctgtagcagccctgccatgcatgcatggcgatgga
agaatgcccatcgaggaatgcaaggcagaagtaaaacctggtttgctctccccagaagta
ccccctggggcttctattcttcctccccctccaccaccttctgttcttcccaaaaggagg
ccgggtcggccgaggcggtccccaccttctgtcctctcgctggatgtgtactcgggcaaa
accatagagcctcctcccatgccagtggccttggtggaaggtcctgtgggcaaagagctg
ttgagtggacatcctgatgcctactatggactgaaagaccctgaagccgtcaccctggac
ttcaggaatgacggtttccacgagaaaatagcagctgagacagttgcagagaaactgcca
ttcaaggagctggagaaccagtggaatgaagacttaaaggaagaagaagctcacgcaaaa
cctaagagacagtggcgaaggcagaagaagacatcagaggagctgcccatgatcccttcc
cctgagtattccccaccccagccgcagttcaggccacgctccgagtttgaggagatgacc
attttgtatgacatctggaacggaggcatcgacgaggaggatatcaaattcatgtgtatc
acatacgaccgcttgctacagcaggacaacggtatggactggctcaatgacaccctgtgg
gttttccatccttctaccagcttttctacccccaagaagaagaagagggatgacgggatg
cgggagcacgtgacgggctgtgcacgaagcgaaggctattacaaaattgataagaaggac
aaactcaaatacctcaacaatagccgagcttttgcagaggagcctccagctgacacacag
ggtatgagcatccctgcccaacctcacgcttccacccgggctggttccgagaggcgatca
gagcaacgcaggctcctctcctccttcactggtagctgcgacagtgacctgctcaagttc
aaccagctcaagttccggaagaaaaagctaaaattctgcaagagccacattcacgactgg
ggcctttttgctatggagcccattgcagctgatgagatggtgatcgagtacgtgggtcag
aacatcaggcaggtcattgctgacatgcgagagaagcgatacgaggatgagggcattggc
agcagttacatgttcagagtcgaccacgacaccatcatcgatgccaccaaatgtgggaac
ttcgccaggtttatcaatcacagctgcaatccaaattgttatgctaaagtgatcacggtg
gagtctcagaagaagatcgttatctactccaagcagcacatcaatgtgaacgaggaaatt
acctacgactacaagtttccaattgaggatgtaaaaatcccatgtctctgtggctctgag
aactgcaggggaaccctgaactga

DBGET integrated database retrieval system