KEGG   Pelagibacterium halotolerans: KKY_1673Help
Entry
KKY_1673          CDS       T01645                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
phl  Pelagibacterium halotolerans
Brite
Translation factors [BR:phl03012]
 Eukaryotic Type
  Elongation factors
   KKY_1673
 Prokaryotic Type
   KKY_1673
Mitochondrial biogenesis [BR:phl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    KKY_1673
Exosome [BR:phl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KKY_1673
  Exosomal proteins of breast cancer cells
   KKY_1673
  Exosomal proteins of colorectal cancer cells
   KKY_1673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEQ51689
UniProt: G4RC41
LinkDB All DBs
Position
complement(1661081..1662271)
Genome map
AA seq 396 aa AA seqDB search
MGKEKFARNKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFSAYDQIDKAPEEKARG
ITISTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDQVDDEELLELVELEVRELLSSYEFPGDDIPITKGSALMALE
DKRPEIGHDAVLELMKTVDDYIPQPERPKDQPFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEVEIVGIKPTLKTTVTGVEMFRKLLDSGEAGDNIGALIRGIDRTQVERGQVLCKPGS
VTPHTKFVAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVTLNEGTEMVMPGDNVE
MNVELIVPIAMEEKLRFAIREGGRTVGAGVVSKIVA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggaaaaatttgcgcgtaacaagccgcactgcaacatcggcacgattggtcac
gttgaccatggcaagacgtcgttgacagcagcgatcacgaaggttctggcggagacaggc
ggggcgacgttctctgcttacgaccagatcgacaaggcgcctgaagaaaaggcccgcggg
atcaccatttcgactgcgcacgtcgaatacgagaccgaaaagcgccactatgcgcacgtc
gactgccctggccacgccgactatgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatccttgttgtttcggctgccgacggcccgatgccgcagacccgcgagcacatt
cttctggcccgtcaggtcggcgtgccggcgctcgtcgtgtttttgaacaaggtcgaccag
gtcgacgacgaagagctgctcgagctggtcgaactcgaagttcgcgaactgctcagctcg
tacgaattccccggtgacgacattccgatcaccaagggttcggccttgatggcgcttgaa
gacaagcgtccggaaatcggtcatgacgcggttctcgagctgatgaagaccgttgacgac
tacatcccgcagcccgaacgtcccaaggaccagccgttcctgatgccggtcgaagacgtg
ttctcgatctcgggtcgtggcacggttgtgaccggtcgcgtcgagcgcggcatcgtcaag
gtcggcgaggaagtcgagatcgttggcatcaagccgactttgaagacgactgtgaccggc
gttgaaatgttccgcaagctgctcgattcgggtgaagccggcgacaacatcggtgctctg
atccgtggtatcgaccgcacgcaggtcgagcgcggtcaggttctgtgcaagcccggttcg
gtgaccccgcacaccaagttcgttgccgaagcctatatcctgaccaaggaagagggtggg
cgtcatacgccgttcttcaccaactaccgcccgcagttctactttaggacgacggacgtg
accggtgtggtgacgctgaacgaaggcaccgagatggtgatgcccggcgacaatgtggaa
atgaacgtggaactgatcgttccgatcgcgatggaagaaaagctccgcttcgccatccgt
gaaggcggccgcaccgtcggcgccggcgtcgtctccaaaatcgtcgcttaa

DBGET integrated database retrieval system