KEGG   Pelagibacterium halotolerans: KKY_1997Help
Entry
KKY_1997          CDS       T01645                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00473  D-Alanine metabolism
phl00550  Peptidoglycan biosynthesis
phl01100  Metabolic pathways
phl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:phl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KKY_1997
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KKY_1997
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    KKY_1997
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:phl01011]
    KKY_1997
Enzymes [BR:phl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KKY_1997
Peptidoglycan biosynthesis and degradation proteins [BR:phl01011]
 Precursor biosynthesis
  Amino acid ligase
   KKY_1997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 Adenine_deam_C GARS_A
Motif
Other DBs
NCBI-ProteinID: AEQ52007
UniProt: G4RFG9
LinkDB All DBs
Position
complement(1974489..1975409)
Genome map
AA seq 306 aa AA seqDB search
MAKHVAVLKGGWSHEREVSLSSGGECAQALRNAGYEVTEIDVKRDIASVLGELKPDVVFN
ALHGRFGEDGTIQGLLEILGIPYTHSGVLASSVAMDKHQAKVMFKSAGVPVTDHVIATRD
AIARSHVMAPPYVVKPYNDGSSVNVFIVKEGQEHPPQEILRTDWDGDEELMVERFIPGRE
LTCAVMGDVALGVIEIVTDLAFYNYEAKYVSGGSRHELPAQVSPKIYEKVQKMSLMAHAA
LGCRGVSRSDFRYDPRGGDDGELVCLEINTQPGMTKTSLVPELAAHAGHSFEELVSWMVE
DASCNR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacatgttgcagtgctcaagggcggatggtcgcacgagcgtgaggtgtcgctg
agctcgggtggcgaatgcgcacaggcgttgcgcaatgccgggtatgaggtcaccgaaatt
gacgtcaagcgcgatatcgcctcggtgctgggcgagctgaagcccgacgtggttttcaat
gcgctgcatggacggttcggtgaggatgggaccatccagggactgctggaaatccttggc
attccctacacccattcgggcgttctggcctcttcggtggccatggacaagcatcaggcc
aaggtgatgttcaaatcggcgggggtgccggtgaccgatcacgtgatcgcaacgcgcgac
gccatcgccaggagccatgtgatggctccgccctatgtggtcaaaccgtacaatgacggt
tcgagcgtcaatgttttcatcgtcaaggagggccaggagcatccgccgcaggaaatcctg
cgcaccgattgggacggcgatgaagagctgatggttgagcggttcattcccgggcgcgag
ctgacctgcgcggtgatgggcgatgtggcgctgggggtgatcgagatcgtgacggacctt
gccttctacaattacgaggcaaaatatgtgagcggcgggtcgcggcacgagttgccggcg
caggtttcaccgaaaatttacgaaaaagttcagaagatgtcgctgatggcgcatgccgct
ttgggttgccgtggggtgtcgcggagcgacttccgctacgacccgcgcggcggtgacgat
ggcgagcttgtgtgccttgaaatcaatacccagccgggaatgaccaaaacctcgctggtc
ccagagttggcggcccatgccggccattcgttcgaagagctggtgagctggatggtggag
gacgcaagttgcaacaggtga

DBGET integrated database retrieval system