KEGG   Pelagibacterium halotolerans: KKY_2479Help
Entry
KKY_2479          CDS       T01645                                 

Definition
(GenBank) inositol-1-monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00521  Streptomycin biosynthesis
phl00562  Inositol phosphate metabolism
phl01100  Metabolic pathways
phl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:phl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    KKY_2479
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KKY_2479
Enzymes [BR:phl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     KKY_2479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: AEQ52487
UniProt: G4R9W0
LinkDB All DBs
Position
2469491..2470282
Genome map
AA seq 263 aa AA seqDB search
MARSALMNIMVNAAMKAGKGLIRDFGEVENLQVSRKGPADFVSVADKRAEKIVMDELMKA
RPTYSFLMEEGGAIKGTDGMHRWIIDPIDGTTNFLHGIPIFAVAIALERNDEIVSSVIYN
PVMDELFTAEKGNGAWLNNRRLRVAGRKHMSEALMCTGINSQGRALDALQLRQLAHITPA
VSGIRRSGSISMDLAWLAAGRFDGVWEAGLKPWDVAPGLLLVKEAGGFLTDFAGGNDAVA
KGEVVAGNEIIQRELLKAIQAVK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctcagcgctgatgaacatcatggtcaatgccgccatgaaggccggcaagggc
ctgatccgcgatttcggcgaagtggaaaacctgcaggtctcgcgcaagggacccgccgat
ttcgtttccgttgccgacaagcgcgccgaaaagatcgtcatggacgagttgatgaaggct
cgacccacctattccttcctcatggaagaaggcggagcaatcaagggcacggacggcatg
caccgctggatcatcgatcccatcgacgggacgaccaatttcctgcacggcattccaata
tttgccgttgccattgcgctcgaacgcaatgacgagattgtttcctcggtcatctacaac
ccggtgatggatgaattgttcaccgccgaaaagggcaatggcgcctggctcaacaaccgc
cgcctgcgcgttgccggccgtaagcatatgtcggaagccctgatgtgcaccggcatcaat
tcgcaaggtcgcgccctcgatgccctgcaactgcgccaattggcccatatcacgcctgcc
gtttccggcatcaggcggtcgggctcgatctcgatggatctcgcctggctggctgccggt
cggttcgatggggtctgggaagccggcctgaaaccctgggacgtcgcgcccggtctgctg
ctggtcaaggaggccggcggctttcttaccgattttgccggcggcaatgatgcggttgca
aagggcgaggtggtcgccggcaacgagatcatccagcgcgagctgctcaaggccatccag
gcggtaaaatag

DBGET integrated database retrieval system