KEGG   Pelagibacterium halotolerans: KKY_3726Help
Entry
KKY_3726          CDS       T01645                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit-related amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00970  Aminoacyl-tRNA biosynthesis
phl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KKY_3726
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:phl03029]
    KKY_3726
Enzymes [BR:phl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     KKY_3726
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     KKY_3726
Mitochondrial biogenesis [BR:phl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    KKY_3726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEQ53708
UniProt: G4RCB4
LinkDB All DBs
Position
3703570..3704880
Genome map
AA seq 436 aa AA seqDB search
MTDISPLRQNAGRIAFRAEDRARRAIDVAMSAKPEVLRTIFTRFDASRIMSEAKALDGDA
GRRTGPLAGILVSIKDLFDEKGQVTSAGSTILADAEPANADAEAVGRLRAAGAIGCGRTT
MSEFAYSGVGLNPHFGNPGNIFDSSRISGGSTSGGALSVALGIADVALGSDTGGSVRIPA
ALNGLCGFKPSQSAVPLDGAFPLSQSYDSIGPLARTIKHCSAVHAVLSATAASPAKRESL
RIGVARGILTEGLDTQVAADFQRAIALLSAAGFALTDIELPMLEGFGNVNRIIVASEAHA
IHASRLARMQTEGDPHVLRRIRAAESFASTDEVDARAQRAAAIAAFSAQAENYDVFIAPT
LPTVAPLIADVEADFDRLNGLMLRNPSAINFLDGCAATVPMHAGQPLATGLMIFAPGGHD
WRVLGAAEQIEAILAS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatctccccgctccgccagaacgccggccgtatcgcctttcgcgccgaagat
cgtgcgcggcgcgccatcgatgtggctatgagtgccaagcccgaagtcctgcgcaccata
ttcacccgcttcgatgccagccggatcatgtccgaagccaaagcgctcgacggtgacgcc
gggcgcagaaccggccctctggccggcatcctcgtctcgatcaaggacctgttcgacgag
aaagggcaggtgacttcggccggctcgaccattctcgctgatgccgaaccggcaaatgcc
gatgcggaggccgtcggacgcctgcgagctgccggggccatcgggtgcggacgcaccacc
atgtccgaatttgcctattcgggcgtggggctcaatccgcactttggcaatccgggaaac
atcttcgacagctcccgcatctccggcgggtcgacctcgggcggcgcattgtcggtcgcc
ctgggcattgccgatgtcgcactgggttccgataccggcggatcggtgcgcattcccgcc
gcgctcaatgggttgtgcgggttcaagcccagccagtccgcggtcccgctcgatggtgcg
ttcccgctgtcccagagctatgacagtatcgggccgctggcgcgcacgatcaaacactgc
agcgccgtccacgccgtcctttcagccaccgccgcctcgccagcaaagcgcgaaagcctg
cgtatcggcgtggcgcgcggcattctgaccgaagggctcgacacccaagtcgccgccgat
ttccagcgcgccatcgcgctgctttccgccgccggatttgcgctgaccgatatcgagctg
cccatgctcgagggcttcggaaacgtcaaccgcatcattgtcgcctccgaagctcatgcc
atccacgcttcccgtctggcccgcatgcaaaccgagggcgatccccacgttctgcgccgc
atccgcgctgccgaaagtttcgcttccacagacgaggtggatgctcgcgctcaacgggca
gccgctatcgcagcgttttcggcgcaggcggaaaattatgatgtattcatcgcacccacg
ctgccgaccgtcgcaccgttgattgccgatgtggaggccgatttcgaccgtctcaatggc
ctgatgctgcgcaacccttcggccatcaactttctcgatggctgcgccgcaaccgttccg
atgcatgccggccagcccctcgccaccggcctcatgattttcgcccccggcggtcatgac
tggagggttctgggcgccgccgaacaaattgaggccattctggcatcatga

DBGET integrated database retrieval system