KEGG   Pelagibacterium halotolerans: KKY_988Help
Entry
KKY_988           CDS       T01645                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
phl  Pelagibacterium halotolerans
Pathway
phl00564  Glycerophospholipid metabolism
phl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KKY_988
Enzymes [BR:phl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KKY_988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEQ51023
UniProt: G4RFY0
LinkDB All DBs
Position
964062..965570
Genome map
AA seq 502 aa AA seqDB search
MSDPVFDIFIVGGGINGCGIARDAAGRGYSVCLAEMNDLASGTSSASTKLIHGGLRYLEH
YEFRLVRESLKEREVLWAMAPHIIWPLRFVLPHHKGLRPAWLLRLGLFLYDHIGGRKRLP
ATKVRDLRQDPLGAVLKPGQGRAFEYSDCWVDDARLVVLTARDAADRGAEIHTRTRMISA
HRVDDHWEITIQDDSGHTRTVRARMLVNAAGPWVSEVLSGLIGGNESHDVRLVKGSHIVV
RKLYDDPRCFFFQNADGRIFFSIPYQGDFTLIGTTDQDFDGDPASVDISPAETDYLLAAA
NQYFRDPIGRDDIVWTYSGVRPLYNDGASRAQEATRDYVLKHTGGGDTPTLLNVFGGKLT
TYRRLAESALEHIETALGRRGDRWTSHSSLPGGDFSVDGFADEVENLQTRYPFLSTENAR
RFVRAYGTLSRTILGDARTAEDLGPDFGCGLTGAEVRYQVEREWARSADDILWRRSKLGL
HGARIDRSALDSYIYEALRASG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacccggtattcgacatcttcatcgtcggcggtgggatcaatggctgcggcatc
gcccgcgatgcggcagggcggggctattcggtctgccttgccgaaatgaacgatctggct
tcgggcacatcctctgcctccacaaagctcattcatggcggcctgcgctatctcgaacat
tacgagttccggctggtgcgcgaatccctaaaggagcgcgaagtgctctgggccatggcc
ccgcatatcatctggccgctgcgtttcgtgctgccccatcacaagggtctgcgtcccgca
tggctcctgcggctcggccttttcctctacgaccacatcgggggccgcaagcgcctgccg
gccaccaaggtgcgcgacctgcgccaggatcccctcggcgccgtgctcaagccggggcag
gggcgggctttcgaatattccgattgctgggtcgatgacgcccgtcttgtcgtattgacc
gcccgcgatgccgccgaccggggcgccgaaatccacacccgcacccgcatgatttcggct
catcgggtcgacgaccactgggaaatcaccatccaggacgattcaggccatacccgaacc
gtacgggcccgcatgctggttaatgccgccggaccgtgggtctccgaggtcctttcgggg
ctgatcggtggcaatgaaagccacgacgtgcggctcgtcaaaggcagccatatcgtggtg
cgcaagctctatgacgatccgcgctgttttttcttccagaacgccgatggccgcatcttc
ttttccatcccctatcagggcgatttcacgctgatcggcaccaccgatcaggacttcgac
ggcgatccggcctctgtcgatatttccccggccgaaaccgactatctgctggcggcggcc
aaccagtatttccgcgatcccatcggcagagacgatatcgtctggacctattcgggcgtg
cgcccgctctacaatgacggcgcgtccagggcccaggaagccacgcgcgactatgtcctc
aagcacacgggcggcggggatacgcccaccctgctcaacgtctttggcggcaaactgacc
acctaccgccggctcgccgaatccgcactcgaacacatcgagaccgcgctcgggcgtcgt
ggtgatcggtggacgtcccactcatcgctgccgggtggagacttctccgtcgacggcttt
gcggacgaagtcgagaacttgcagactcgctacccgtttctctcaaccgaaaatgcccgc
cggttcgtccgtgcctatggcacgctctcgcgaaccatccttggtgacgcccgcacggca
gaagacctcggtcccgatttcggctgcggcctgaccggcgccgaggtacgctatcaggtc
gagcgcgaatgggcgcgcagcgccgatgacattctctggcgccgctccaagctcggcctg
catggcgcgcggatcgaccgttctgcgctcgattcgtacatctacgaagccctccgtgcc
tcaggctag

DBGET integrated database retrieval system