KEGG   Phycisphaera mikurensis: PSMK_22640
Entry
PSMK_22640        CDS       T01800                                 

Definition
(GenBank) hypothetical protein
Organism
phm  Phycisphaera mikurensis
SSDB
Motif
Pfam: PilZ
Other DBs
NCBI-ProteinID: BAM04423
UniProt: I0IGN5
LinkDB
Position
2688145..2688594
AA seq 149 aa
MPATEESAESLPPAPLPFAPHAAARRQERLKLPAMYTQVRAKQPGAARYTLSGHLYDVSM
TGLRFELDEPLPAGQHLHFRVQLPGEEQATVRLEGSIVRLHDESNEPGPVRMGAQIVKFL
WPTDRTILEDYLQARGVSTGGESTMRLAA
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcccgccaccgaagaatccgccgaatccctcccgcccgccccgctgcccttcgccccg
cacgcggcggcgcgtcggcaggagcggctgaagctgcccgcgatgtacacccaggtccgg
gcgaagcagcccggggccgcgcggtacacgctgtcgggccacctctacgacgtgtcgatg
acgggcctccgcttcgagctcgacgagccgctgcccgccggccagcacctgcacttccgc
gtgcagctgcccggcgaggagcaggcgaccgtccgcctggaaggctcgatcgtccgcctg
cacgacgagagcaacgagcccgggccggttcgcatgggggcgcagatcgtgaagttcctc
tggccgaccgaccggacgatcctcgaggactacctgcaggcccgaggcgtctccaccggc
ggcgagagcacgatgcgcctcgcggcctag

DBGET integrated database retrieval system