KEGG   Phycisphaera mikurensis: PSMK_25500Help
Entry
PSMK_25500        CDS       T01800                                 

Definition
(GenBank) putative zinc-containing alcohol dehydrogenase
Organism
phm  Phycisphaera mikurensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 HI0933_like Pyr_redox_2 Pyr_redox AlaDh_PNT_C 3HCDH_N AdoHcyase_NAD 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: BAM04709
UniProt: I0IHH1
LinkDB All DBs
Position
complement(3043044..3044063)
Genome map
AA seq 339 aa AA seqDB search
MPAALLQADKSFQIQDTESIAPAEGQVRLEVAFCGVCGTDLHIFKGHMDRRVAFPEVIGH
EASATVAEVGPGVTSVEPGDAVVVRPLDACGDCAACRKGFGHVCTNLNFIGIDSPGAFQG
SWTVPAGLVHELPGGLDLKMAAFVEPLAVACHDVRMAGLRAGEAAVVLGGGPIGMLIAMV
ARATGAEVILSEVNPKRLELARTLGVAGVNPVSEDVPAFVKEHNGGELADVVFEVSGAAP
AIAQMTHLACVRGRVVVVAIVPEPAKVDLFQVFWKELKIIGTRVYEPQDYDRAIAMLADG
SIDPSPLVTGEYPLTRVDEAFDSLSNSPDHMKILIDCRG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgcgctcctccaagccgacaagtcgtttcagatccaggacaccgagtcgatt
gcgccggcggagggtcaggtccgcttggaggtcgccttctgcggcgtgtgcggcaccgac
ctgcacatcttcaaggggcacatggaccggcgcgtcgccttccccgaggtgatcgggcac
gaggcgagcgcgaccgtggccgaggtggggccgggcgtcacgagcgtggagccgggcgac
gccgtggtggtccgcccgctcgacgcctgcggcgactgcgccgcctgcaggaagggcttc
ggccacgtgtgcacgaacctgaacttcatcggcatcgactcgccgggcgccttccagggc
agctggaccgtgccggcgggcctcgtccacgagctgcccggggggctggacctgaagatg
gcggccttcgtcgagccgctggcggtggcctgccacgacgtgcggatggccgggctgcga
gcgggcgaggcggcggtggtgctcggcggcgggccgatcgggatgctgatcgccatggtc
gcccgggccaccggcgcggaggtgatcctctcggaggtgaaccccaagcggctggagctg
gcgagaacgctgggcgtcgccggcgtgaaccccgtgagcgaggacgtgccggccttcgtg
aaagagcacaacggcggcgagctggcggacgtggtcttcgaggtttccggtgccgcgccc
gccatcgctcagatgacgcacctggcctgcgtccgcggccgggtggtcgtcgtggcgatc
gtgcccgagccggcgaaggtcgacctgttccaggtcttctggaaggagctgaagatcatc
ggcacccgcgtctacgagccccaggactacgaccgggcgatcgcgatgctggccgacggg
tccatcgacccgagccccctggtgaccggggagtacccgctgacgcgggtcgatgaagcc
tttgattcgctgtctaacagcccggaccacatgaagatcctgatcgactgccgcggctga

DBGET integrated database retrieval system