KEGG   Phycisphaera mikurensis: PSMK_25500
Entry
PSMK_25500        CDS       T01800                                 

Definition
(GenBank) putative zinc-containing alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
phm  Phycisphaera mikurensis
Pathway
phm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:phm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PSMK_25500
Enzymes [BR:phm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PSMK_25500
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PSMK_25500
    1.1.1.-  
     PSMK_25500
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 HI0933_like Pyr_redox_2 Pyr_redox AlaDh_PNT_C 3HCDH_N AdoHcyase_NAD 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: BAM04709
UniProt: I0IHH1
LinkDB
Position
complement(3043044..3044063)
AA seq 339 aa
MPAALLQADKSFQIQDTESIAPAEGQVRLEVAFCGVCGTDLHIFKGHMDRRVAFPEVIGH
EASATVAEVGPGVTSVEPGDAVVVRPLDACGDCAACRKGFGHVCTNLNFIGIDSPGAFQG
SWTVPAGLVHELPGGLDLKMAAFVEPLAVACHDVRMAGLRAGEAAVVLGGGPIGMLIAMV
ARATGAEVILSEVNPKRLELARTLGVAGVNPVSEDVPAFVKEHNGGELADVVFEVSGAAP
AIAQMTHLACVRGRVVVVAIVPEPAKVDLFQVFWKELKIIGTRVYEPQDYDRAIAMLADG
SIDPSPLVTGEYPLTRVDEAFDSLSNSPDHMKILIDCRG
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgcccgccgcgctcctccaagccgacaagtcgtttcagatccaggacaccgagtcgatt
gcgccggcggagggtcaggtccgcttggaggtcgccttctgcggcgtgtgcggcaccgac
ctgcacatcttcaaggggcacatggaccggcgcgtcgccttccccgaggtgatcgggcac
gaggcgagcgcgaccgtggccgaggtggggccgggcgtcacgagcgtggagccgggcgac
gccgtggtggtccgcccgctcgacgcctgcggcgactgcgccgcctgcaggaagggcttc
ggccacgtgtgcacgaacctgaacttcatcggcatcgactcgccgggcgccttccagggc
agctggaccgtgccggcgggcctcgtccacgagctgcccggggggctggacctgaagatg
gcggccttcgtcgagccgctggcggtggcctgccacgacgtgcggatggccgggctgcga
gcgggcgaggcggcggtggtgctcggcggcgggccgatcgggatgctgatcgccatggtc
gcccgggccaccggcgcggaggtgatcctctcggaggtgaaccccaagcggctggagctg
gcgagaacgctgggcgtcgccggcgtgaaccccgtgagcgaggacgtgccggccttcgtg
aaagagcacaacggcggcgagctggcggacgtggtcttcgaggtttccggtgccgcgccc
gccatcgctcagatgacgcacctggcctgcgtccgcggccgggtggtcgtcgtggcgatc
gtgcccgagccggcgaaggtcgacctgttccaggtcttctggaaggagctgaagatcatc
ggcacccgcgtctacgagccccaggactacgaccgggcgatcgcgatgctggccgacggg
tccatcgacccgagccccctggtgaccggggagtacccgctgacgcgggtcgatgaagcc
tttgattcgctgtctaacagcccggaccacatgaagatcctgatcgactgccgcggctga

DBGET integrated database retrieval system