KEGG   Phycisphaera mikurensis: PSMK_31520Help
Entry
PSMK_31520        CDS       T01800                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
phm  Phycisphaera mikurensis
Pathway
phm00020  Citrate cycle (TCA cycle)
phm00480  Glutathione metabolism
phm01100  Metabolic pathways
phm01110  Biosynthesis of secondary metabolites
phm01120  Microbial metabolism in diverse environments
phm01130  Biosynthesis of antibiotics
phm01200  Carbon metabolism
phm01210  2-Oxocarboxylic acid metabolism
phm01230  Biosynthesis of amino acids
Module
phm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:phm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSMK_31520 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PSMK_31520 (icd)
Enzymes [BR:phm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PSMK_31520 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAM05311
UniProt: I0IJ73
LinkDB All DBs
Position
complement(3742480..3743919)
Genome map
AA seq 479 aa AA seqDB search
MAVAHGDGIGPEIMDATLRVLDAAGAGLVYDTIEIGKKVYERGVSAGIEASSWDTLRKHR
VFLKAPITTPQGGGYKSLNVTTRKTLGLYANVRPCVAYAPFVGSRHPGMDVVIVRENEED
TYGGIEHRQTAEVTQCLKLISRPGCEKIVRHAFEYARAAGRKRVSCFTKDNIMKATDGLF
HRVFDEIRGEYPEIESDHWIIDIGAAMLADRPERFDVILTLNLYGDVLSDIAAQIAGSVG
LCGTSNIGDTCSMFEAIHGSAPDIAGRDVANPTGLLLAAVQMLVHLNKPGAAEKIHNAVL
RTIEDGVHTADLHDGRGHDPVGTRAFADAVIQRLGQRPEHLPAAVYAGVADRAAPGVGPA
TREKPVKALVGVDVFLDWDPAERDPDALAAELHAAADGQPLQLQMITNRGVKVWPEGFPE
TFCTDHWRCRFVPRGGGEASHRQVLGLLTRLADAGLDFIKTEHLCTFDGEAGFSLGQGQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtcgcgcacggcgacggcatcggccccgagatcatggacgcgacgctccgcgtg
ctcgacgcggccggtgccggcttggtctacgacaccatcgagatcggcaagaaggtctac
gagcgcggcgtctccgcgggcatcgaggcctcttcgtgggacacgctccggaagcaccgg
gtgttcctgaaggccccgatcaccacgccccagggcggcggctacaagtcgctgaacgtg
acgacccgcaagacgctggggctttacgcgaacgtacgcccgtgcgtcgcctacgcgccc
ttcgtcgggagccggcacccgggcatggacgtcgtgatcgtccgcgagaacgaggaggac
acctacggcggcatcgagcaccgccagacggccgaggtgacgcagtgcctcaagctcatc
tcgcggcccggctgcgagaagatcgtccgccacgccttcgagtacgcccgcgccgccggc
cgcaagcgggtcagctgcttcacgaaggacaacatcatgaaggcgaccgacggcctcttc
caccgggtcttcgacgagatccgcggcgagtaccccgagatcgagtcggaccactggatc
atcgacatcggcgccgcgatgctcgccgaccggcccgagcgcttcgacgtgatcctcacg
ctgaacctctacggcgacgtgctctcggacatcgccgcccagatcgccggcagcgtcggc
ctgtgcggcacctcgaacatcggcgacacctgctcgatgttcgaggcgatccacggcagc
gcccccgacatcgccgggcgcgacgtcgccaaccccacgggcctgctgctcgcggccgtg
cagatgctcgtgcacctcaacaagcccggggccgccgagaagatccacaacgcggtgctc
cgcacgatcgaggacggcgtgcacaccgccgacctgcacgacggccggggccacgacccg
gtcggcacccgcgccttcgccgacgcggtgatccagcggctcggccagcggcccgagcac
ctgccggccgcggtctatgccggggtcgcggatcgcgcggccccgggcgtcgggccggcg
acgcgggagaagccggtgaaggcgctcgtcggggtggacgtcttcctggactgggacccg
gcggagcgggaccccgacgcgctcgccgcggagctccacgcggcggccgatggccagccg
ctccagctgcagatgatcaccaaccggggcgtgaaggtgtggccggagggcttccccgaa
accttctgcaccgaccactggcgctgccgcttcgtgccccggggcgggggcgaggcctcg
caccggcaggtcctcggcctgctgacccggctcgccgacgccgggctggacttcatcaag
accgagcacctgtgcaccttcgacggcgaggcgggcttctcgctcggccaggggcagtag

DBGET integrated database retrieval system