KEGG   Paenalcaligenes hominis: PAEH1_06240Help
Entry
PAEH1_06240       CDS       T04704                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
phn  Paenalcaligenes hominis
Brite
KEGG Orthology (KO) [BR:phn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAEH1_06240
Enzymes [BR:phn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PAEH1_06240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like FAD_binding_2 Thi4 DAO NAD_binding_8 FAD_binding_3 Glutaredoxin K_oxygenase Lycopene_cycl AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AQS51251
UniProt: A0A1U9JZR7
LinkDB All DBs
Position
complement(1236714..1238267)
Genome map
AA seq 517 aa AA seqDB search
MLDAGLKTQLKAYLENITHPIELIASLDEGAKSVELRELLQEIAELSPAKVSFSENGNNA
RKPSFKIQRLESDVAVDFAGIPLGHEFTSLVLALLQVGGHPIKMDEMVANQIRGLDQDLV
FETYYSLSCQNCPDVVQALNAMAVLNPRIKHTSIDGALFQDEVKEREVMSVPAVFLNGAE
FHYGRANAEELLAKLGTGNSEEQIAALNEKEAFDVLIVGGGPAGAAAAVYAARKGIRTGV
VAERFGGQVLDTMSIENYISVQYTEGPQFAAALEAHVRDYDVDIMNVQRAEKLIPGKEIQ
LQLENGATLKTKSLILATGARWRELGVPGEAEYRNKGVAYCPHCDGPLYKGKDVAVIGGG
NSGVEAAIDLAGLVNHVTLIEFGDALRADEVLQRKLHSLPNVTVLKKAQTTEVLGDGSKV
TALRYVDRDTQQSHDVALDGIFVQIGLVPNNEWLGDVIERSPHGEIVIDDRGQTSIPGVF
AAGDATTVPYKQIIIAAGQGATAALSAFDYLIRSSVE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaggtttaaaaacacagcttaaagcgtatttggaaaacatcacgcaccca
atcgagctaattgcgtcactcgatgaaggcgccaagtcagtcgagttgcgcgagttactg
caagaaatagcagaacttagccctgctaaggtttcattcagtgaaaacggaaataatgcg
cgcaaaccgtcttttaaaattcaacgactagaaagtgatgtggcagtagattttgctggc
attcctttgggtcatgaattcacgtcgttagttttggcattgctacaagtcggtggccac
cccatcaagatggatgagatggtggcaaatcaaatccgtggtttagatcaagacttggtg
tttgaaacctattactcattaagctgccaaaactgcccagatgtggtccaagcactcaac
gcaatggccgtgttaaacccacgtatcaaacatacttccattgatggcgccttattccaa
gacgaggtgaaagagcgtgaggtcatgtccgtacctgccgtatttttaaacggagcagag
tttcattacggtcgcgctaatgccgaagagctattggccaaattaggtacaggcaacagt
gaagaacaaattgcagcactgaatgaaaaagaggcttttgatgtgctgattgtgggtggt
ggtcctgctggtgcggcagccgctgtgtatgctgcgcgtaaaggtattcgcacgggtgtg
gtagccgaacgctttggcggtcaggtactagacaccatgtctatcgagaactatatctca
gtgcaatatactgaaggcccacaatttgcagcagcactcgaagcgcatgtccgtgactac
gacgtagatatcatgaatgtgcagcgtgcggaaaaactcatccctggcaaggaaattcag
ttgcagcttgaaaatggcgcgaccttgaaaaccaagtctctgattttggctactggtgcc
cgttggcgcgagctaggtgtgcccggcgaggcagaataccgtaacaaaggggtcgcttac
tgcccacattgcgatggcccgctgtacaaaggcaaagacgtagcggtgattggtggtggt
aattcaggcgtagaggccgctatcgatttagctggcttagtgaatcatgtcacattgatt
gagtttggcgatgcgttgcgtgctgacgaggtgttacagcgtaaattgcatagcctacct
aacgtaaccgtccttaaaaaagcgcaaactaccgaagtgttgggcgatggttctaaagtc
actgccttacgctatgtagatcgcgacacgcagcaaagtcatgatgtggcattagatggc
atatttgtgcaaattggactcgttcctaataatgaatggttaggcgatgtcatagagcgt
agcccacatggtgaaatcgttatcgatgaccgaggccaaacctcgattcccggtgtattt
gctgccggcgacgccaccactgttccttataaacagattatcattgcagcaggccaaggc
gctacagccgctttaagcgcttttgattatttaattcgatcatctgtcgagtaa

DBGET integrated database retrieval system