KEGG   Paenalcaligenes hominis: PAEH1_08970Help
Entry
PAEH1_08970       CDS       T04704                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
Organism
phn  Paenalcaligenes hominis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AlaDh_PNT_C PALP 2-Hacid_dh_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AQS52363
UniProt: A0A1U9K2S5
LinkDB All DBs
Position
complement(1791067..1792077)
Genome map
AA seq 336 aa AA seqDB search
MQAAIFEGFGKPLRVEKIPAPTPGSDEVILAVKRCGICGSDLHMTEDPTFNLQPGSVLGH
EFAGEVIALGKDVTHLKVGQQVAVMPYHSCGHCAQCLARNPAWCSEMTLMGGGYGEFAAV
AARLCIPLPAETDFETGALVEPLAIALHGVRKSGLQPGQDIIVYGAGPIGLAVVFWARRF
GARKIIVEDIKPERANQALELGANHFVCAPHLPTETTAAKLGNQGADIVFDCAGVPGLIT
QAIPLLRPQGTLLILGLCTKPDSFIPFEALSKELRIQTAVFFDQQEYESALDMLTAMPVL
VDVFINKRTSLHTLPALFETLKSNSPYCKVMICHEH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagctatttttgaggggttcggcaaaccacttcgggtagagaaaatccctgct
ccgactcctggtagcgatgaagtcattctagccgtcaaacgctgcggcatctgtggttct
gatttacacatgaccgaagaccccacctttaaccttcaacctggcagcgtattgggtcac
gaatttgcaggagaagtcatcgctctgggtaaagacgtcacgcatctaaaagtagggcaa
caagtggctgttatgccctatcatagttgcggtcactgtgctcaatgccttgcccgtaat
cccgcttggtgctcagaaatgaccctaatgggcggtggttatggcgaatttgccgctgtc
gcagcccgcctttgcattcccttacccgctgaaaccgactttgagacgggagctttggtt
gaacctctggctattgctttgcacggtgttagaaaatcaggccttcagccagggcaagac
attattgtctacggtgctgggccaatcggtttagccgtcgtattttgggctcgccgcttt
ggtgccagaaaaattatcgtagaagacatcaaaccagagcgcgcaaatcaagcgttggaa
ttaggcgccaaccatttcgtttgtgcaccgcacctgcctacagaaaccactgctgccaag
cttggcaaccaaggggctgatattgtgtttgactgcgctggcgttcccggcttaatcaca
caagccatccccctattacgcccgcaaggtaccttgcttattctaggtctgtgcacaaaa
cctgacagctttatcccttttgaagctctatccaaagagctgcgtattcaaactgctgtc
ttttttgatcaacaggaatatgagtcagcattagatatgctaacggctatgcctgtttta
gtagatgtttttattaataaacgcacctctttacataccttacccgcgttatttgagaca
cttaagtcgaactcaccctattgcaaagtcatgatttgtcatgagcactaa

DBGET integrated database retrieval system