KEGG   Pyrococcus horikoshii: PH0016Help
Entry
PH0016            CDS       T00014                                 

Gene name
PH0016
Definition
(GenBank) 475aa long hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00620  Pyruvate metabolism
pho00680  Methane metabolism
pho00720  Carbon fixation pathways in prokaryotes
pho01100  Metabolic pathways
pho01120  Microbial metabolism in diverse environments
pho01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PH0016 (PH0016)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PH0016 (PH0016)
   00680 Methane metabolism
    PH0016 (PH0016)
Enzymes [BR:pho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PH0016 (PH0016)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAA29084
UniProt: O57764
LinkDB All DBs
Position
complement(13689..15116)
Genome map
AA seq 475 aa AA seqDB search
MRSKGVMIPRIMSTQHPDNYSIPFFASSPILGGEDEITEAFYAFSVLGADEQMWDFEGKE
VDEFVVKKLLERYPTFFKENILGEDLRLTPRVPNPSVEKAEAKLLLETLQGITRAADYAR
VFYLDNIAPIFEVILPMTTSLAEMLRVHELYRKIVSLSGEVIYDVTVKEWIGEFYPKEIN
VIPLFETKVALLKSGRIIREYIGRKRPEYLRVFFARSDPAMNYGLLSAVTYVKKALEQVG
EVEEETSTPIYPIIGVGSPPFRGGMRPENVKKVLKEYPSVQTYTIQSSFKYDHPTKDVVK
AVEIVKSKKREAPDPLDIPEFIQLYEIEYQKQLKILAPYIRNIVTRIPDRRKRKLHIGLF
GYSRNVGGLSLPRVIKFTASLYSIGLPPELLGLNELSDNQLDSISEYYKNLYDDLEFAMR
FFSFKVAERVGLRELSEKVKEFKPDIDDEYVREAELVFRGQGDVMKLAQIRGFLG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcaagggcgttatgatacctagaataatgagtactcaacatcctgacaactac
tcgataccattctttgcaagttcacccatactcggaggggaggatgagataactgaagcc
ttctatgcctttagtgttctcggagcagatgaacaaatgtgggatttcgaaggaaaagag
gttgacgagtttgtcgttaagaaattacttgagaggtatccaacattttttaaagaaaat
atcttgggcgaggacttaaggttaacgcctagggttccaaacccaagcgttgagaaggcg
gaggctaagctgttacttgaaaccttgcaaggaataactagggctgctgactatgcgagg
gttttctaccttgataacatagctccaatctttgaggtaatactcccaatgacaacgagt
ttagccgagatgttaagagttcatgagctttataggaagatagtctccctctcaggggag
gtaatatatgacgtaaccgttaaggaatggataggtgaattttatccaaaagagataaat
gttatacctctttttgagacaaaagttgccttgttaaagtctggaaggataattagggag
tacataggaaggaaaaggccagaatacttgagagtcttctttgcaaggagcgaccctgcg
atgaactacggtctcctttccgctgtaacatacgttaagaaggcccttgagcaggtcggc
gaggtcgaggaggagacctcaacccctatatatccaataattggggtaggaagcccaccg
tttagaggtgggatgaggccggagaacgttaaaaaagttctcaaggagtatccaagcgtt
cagacatatacaatccagagtagcttcaaatatgaccatccaactaaggatgtcgtgaag
gccgtggaaatcgttaagtcgaaaaagcgtgaagctcccgaccctttggatattccagaa
ttcattcagctctatgagatagaataccagaagcaactcaaaattttagctccctatata
aggaacatcgtcacgaggatccctgacagaagaaaaagaaagcttcacattggactcttt
ggatattccaggaatgtaggcggtttatctcttccaagggttataaagttcacggcttct
ctgtactctattggacttcctcctgagctacttggacttaatgagttaagtgataaccaa
ctcgatagtatatctgaatactacaaaaacttatatgatgacctagagtttgccatgagg
ttcttcagctttaaagttgccgagagagttggtcttagggaattgtctgagaaagttaaa
gaatttaagcccgacatagatgatgagtatgtaagggaagcggaactagtgtttagggga
cagggggatgttatgaagttggcccaaattaggggattcctgggatga

DBGET integrated database retrieval system