KEGG   Pyrococcus horikoshii: PH0939Help
Entry
PH0939            CDS       T00014                                 

Gene name
PH0939
Definition
(GenBank) 430aa long hypothetical ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00630  Glyoxylate and dicarboxylate metabolism
pho01100  Metabolic pathways
pho01120  Microbial metabolism in diverse environments
pho01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PH0939 (PH0939)
Enzymes [BR:pho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PH0939 (PH0939)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N B12-binding
Motif
Other DBs
NCBI-ProteinID: BAA30036
UniProt: O58677
LinkDB All DBs
Structure
PDB: 

Position
848437..849729
Genome map
AA seq 430 aa AA seqDB search
MMVLRMKVEWYLDFVDLNYEPGRDELIVEYYFEPNGVSPEEAAGRIASESSIGTWTTLWK
LPEMAKRSMAKVFYLEKHGEGYIAKIAYPLTLFEEGSLVQLFSAVAGNVFGMKALKNLRL
LDFHPPYEYLRHFKGPQFGVQGIREFMGVKDRPLTATVPKPKMGWSVEEYAEIAYELWSG
GIDLLKDDENFTSFPFNRFEERVRKLYRVRDRVEAETGETKEYLINITGPVNIMEKRAEM
VANEGGQYVMIDIVVAGWSALQYMREVTEDLGLAIHAHRAMHAAFTRNPRHGITMLALAK
AARMIGVDQIHTGTAVGKMAGNYEEIKRINDFLLSKWEHIRPVFPVASGGLHPGLMPELI
RLFGKDLVIQAGGGVMGHPDGPRAGAKALRDAIDAAIEGVDLDEKAKSSPELKKSLREVG
LSKAKVGVQH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgctccgcatgaaagttgagtggtatcttgacttcgttgatctaaactatgaa
cctggaagggatgagctgatagtggaatactactttgagccgaacggtgtctccccagag
gaagccgccggtaggatagccagcgagagttctattggtacttggacaacactctggaag
cttccggagatggcgaagaggagtatggctaaggttttctacttagaaaaacacggggag
ggatacatagctaagatagcctaccccctaactctcttcgaggagggaagcctagttcaa
ttgttcagtgcagtagctggaaacgtctttggaatgaaggctttgaaaaacctaagacta
ctggacttccatccaccatatgaatacttaaggcactttaaaggcccccagtttggggtt
cagggaataagggagttcatgggcgttaaggacaggccattaacggcaacggttccaaag
ccaaagatggggtggagcgttgaggaatatgctgagatagcttacgaactctggagtggt
ggtatagaccttctaaaggatgatgagaacttcacgagctttcccttcaacaggtttgaa
gagagggtcagaaagctctacagggttagggatagggttgaggccgagactggggaaact
aaggaatatctgataaatataacgggcccagttaacattatggagaagagagcagagatg
gttgccaatgagggaggacagtacgtgatgatagatatagtggtggcaggatggagcgcc
ctccagtatatgagggaagttaccgaagatctaggcttagcaatacatgcccacagggct
atgcatgcagctttcacaaggaacccaaggcatggaataactatgctagccttggcaaag
gccgctagaatgataggtgttgatcaaatacacacaggaacggccgttgggaagatggcc
ggtaattacgaggagataaagaggattaatgacttcctcttaagtaagtgggagcacata
agacctgtattccctgtggccagtggaggtctccatccaggattgatgccagagttaata
aggctctttggaaaggacttagtgattcaagcaggcggcggggttatggggcacccagat
ggtcctagggccggggccaaagctctcagagatgcaatagatgccgcaatcgaaggggtt
gacttagatgaaaaagcaaaatcgagtccggaacttaaaaaaagccttagagaagtgggg
ttatctaaagccaaagtaggtgtccaacattga

DBGET integrated database retrieval system