KEGG   Pyrococcus horikoshii: PH1512Help
Entry
PH1512            CDS       T00014                                 

Gene name
PH1512
Definition
(GenBank) 837aa long hypothetical protein
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00500  Starch and sucrose metabolism
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PH1512 (PH1512)
Enzymes [BR:pho01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     PH1512 (PH1512)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Capsule_synth
Motif
Other DBs
NCBI-ProteinID: BAA30620
UniProt: O59181
LinkDB All DBs
Position
complement(1346072..1348585)
Genome map
AA seq 837 aa AA seqDB search
MIMMKVDNSTKERILEKLPENLSRLADLAYNYWWSWDHKAMKLWQKIDEEHWREYKNPVK
LLLEAPESRLRELSRDDNFLDLYELVIERFDDYMKETATWFSTNYPRWDKPIIYLCMEYG
IGKSLPIYSGGLGILAGDHLKTASDLGLPMVAIGLLYKHGYFKQEIDINGRQIERFPEYN
VKEMPIRQVLDNDGSPLLIDVPIEDRMIKARVFLVEVGRVKLYLLDTDVPENSEADRKIC
DYLYNAEPDKRIKQEILIGIGGMRLLKALEIDPGVVHLNEGHAAFANFERIRWFIEKGLS
FEEALEIVRGTSVFTTHTPVPAGHDVFPVEFVREKLRAFFDGLPEDKLLGLGKVNDSDPN
FNMTVLAIRTSEFVNAVSKLHAKVTREMWANLWPGVPPDEIPIEPITNGIHTPTWVNENL
AKLYEIYIGKIWREHVNLEGIWYAIERIPDHELWEAHLKAKRELIELIRRKIMKRNERLG
IDEPIPDVDENALIIGFARRFATYKRAILLFTDLERLKRIVNNRDRPVYIIFGGKAHPMD
EAGKEYLRRVYEVSQMPEFKGKIILIENYDLGSARILISGVDVWLNTPKRPLEASGTSGM
KAGLNGVLNLSTFDGWWVEGYNGRNGWVIGDATLEPETEEDDYLDAMSLYDLLENVVIPM
YYENREGWIRIMKESIKSIAPRFSTYRMLKEYMTKFYSRAMETGIYLSRDNFRWAKELAS
WKEKIMLGWNDVEIEDVKVNENRIEAIIRLGTIRPEDVRVELYYGVRGDGKIMEPYTVEL
RKTKELGTGKYLYTYSGKALKNFNHECWHYSIRVYAYHPMIPGKFLLGGYIKWRDLK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
gtgataatgatgaaagtagataattcaacgaaagagaggatattagaaaaacttcctgaa
aatttatcgaggcttgccgatttagcatataactactggtggagctgggatcataaagcc
atgaaactttggcaaaaaatcgatgaggaacactggagagagtacaagaacccagttaag
ttattgcttgaagcccccgagtcaaggctaagggaactatcaagggatgataactttttg
gacttatacgagctcgttattgaaagattcgacgattacatgaaggaaactgctacatgg
ttttcaactaactatcctcggtgggataaaccgataatctatctttgtatggaatatggg
atagggaagagccttccaatatattcaggaggcctcggaatactagctggagatcatcta
aaaaccgctagcgatcttgggcttccaatggttgcaataggattattatacaagcatggc
tactttaagcaagaaatagatattaatggtaggcaaattgagaggttccccgagtacaat
gtaaaggaaatgcccataaggcaagttctcgataacgatggatctcctcttttaatcgac
gttccaatagaggatagaatgatcaaggctagggtgtttctcgttgaagtaggaagggta
aagctgtatcttctagatactgacgttccagagaactccgaggcagacagaaagatatgc
gattacctgtataatgctgaacctgataagagaataaagcaagaaatcttgataggaatc
ggtgggatgagattattaaaggctttagaaatagatcctggggttgtacatctaaatgag
gggcatgcagcgtttgccaactttgaaaggatcagatggttcattgaaaagggcctcagt
tttgaagaggccttagaaatagttaggggaactagcgtatttactacgcataccccagtc
cccgcgggtcatgatgtatttccggttgaattcgtaagggagaagctgagggcattcttc
gatggtctgcccgaggataagctcctgggacttgggaaagttaacgatagcgatcctaat
tttaacatgactgtgttggcaataagaacatcagaattcgtaaacgcggtaagtaagctt
catgctaaagttactagggaaatgtgggcgaacctttggccaggagtaccacctgatgaa
atcccgatagagcccataacaaatgggatccataccccaacatgggttaatgaaaacttg
gcaaagctctatgaaatatacattggaaagatatggagggaacacgttaacttagagggc
atctggtatgcgattgaaaggattccagatcatgagctttgggaagctcatttaaaggct
aagcgggaattaatagaactaataagaaggaagataatgaaaagaaatgagaggttaggg
atagacgagcctataccagatgtagatgagaacgccttaataatcggattcgcaagaagg
tttgccacatataagagggcaattttactgtttacagatcttgaaaggctaaagaggata
gttaacaacagggatagacccgtatacataatttttggagggaaggcccatccaatggat
gaggcaggaaaagagtacttaagaagggtctatgaagtgtcgcaaatgccagagttcaag
ggaaagataattctaattgaaaactatgatctcggttccgcaaggatccttatctccggg
gttgatgtatggcttaatactccaaagaggccccttgaggccagcggaactagcggaatg
aaagctggattgaatggagtgcttaatttaagcacctttgatgggtggtgggtcgaggga
tacaacggaaggaacggatgggttataggagatgctaccttagaacctgagactgaagag
gatgactacctagatgctatgagcctctatgacctcttagagaacgttgtaattccaatg
tactatgagaatagagaaggatggataaggatcatgaaagagagcataaagagcatagca
ccaaggttcagtacttatagaatgcttaaggaatacatgacgaagttctattcaagggcc
atggagacgggaatatacttaagcagggataactttaggtgggcaaaggagcttgcaagc
tggaaagagaagataatgttgggatggaatgatgttgaaatagaagacgtaaaggttaat
gaaaaccgtatagaggcaataataaggttaggtaccataaggccggaagacgtaagggtt
gagctatactatggagtcaggggagatggaaagatcatggaaccctataccgtcgagctg
aggaagactaaggagttaggaaccggaaaatatctgtacacgtattcagggaaggcctta
aagaacttcaatcacgaatgctggcactattctataagggtttatgcgtatcatccaatg
attccaggaaaattcttacttggaggctacataaaatggagggaccttaagtaa

DBGET integrated database retrieval system