KEGG   Phaeobacter porticola: PhaeoP97_01777Help
Entry
PhaeoP97_01777    CDS       T04595                                 

Gene name
pdhB
Definition
(GenBank) pyruvate dehydrogenase E1 component subunit beta
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
php  Phaeobacter porticola
Pathway
php00010  Glycolysis / Gluconeogenesis
php00020  Citrate cycle (TCA cycle)
php00620  Pyruvate metabolism
php01100  Metabolic pathways
php01110  Biosynthesis of secondary metabolites
php01120  Microbial metabolism in diverse environments
php01130  Biosynthesis of antibiotics
php01200  Carbon metabolism
Module
php_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:php00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PhaeoP97_01777 (pdhB)
   00020 Citrate cycle (TCA cycle)
    PhaeoP97_01777 (pdhB)
   00620 Pyruvate metabolism
    PhaeoP97_01777 (pdhB)
Enzymes [BR:php01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     PhaeoP97_01777 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C Biotin_lipoyl Biotin_lipoyl_2 PFOR_II QRPTase_N RnfC_N
Motif
Other DBs
NCBI-ProteinID: APG47190
UniProt: A0A1L3I4Y4
LinkDB All DBs
Position
1832835..1834220
Genome map
AA seq 461 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLVKEGDTVTSGDILAEIETDKATMEFEAVDEGTIGKIL
IGEGTENVKVNSPIAVLLEDGESYDPDAAPAASTPSASEAPAAEAPAAPATAAAAAAAPA
APEVDTTPDWPEGTEVVQTTVREALRDAMAEEMRGDEDVFLMGEEVGEYQGAYKISQGLL
DEFGPKRVIDTPITEHGFAGIATGAAFGGLRPIVEFMTFNFAMQAIDHIINSAAKTLYMS
GGQMGAPMVFRGPNGAAARVGAQHSQDYAAWYMQIPGLKVAMPYSASDAKGLMKTAIRDN
NPVIFLENEILYGKSFDVPKLDDYTVPFGKARIWRKGEDVTIVSFGIGMTYALEAAEKLA
EEGISAEVIDLRTLRPMDTGSIIKSVMKTNRLVTVEEGWPQGSVGSYISSVVMQEAFDYL
DAPVITCTGKDVPMPYAANLEKHALVTTDEVIEAVKQVTYR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaaatcctgatgcccgccctgtcgccaaccatggaggaaggcaccctggcc
aaatggctggtcaaagagggcgataccgtaacctctggcgacatcctcgccgagatcgaa
accgacaaggcgacgatggagttcgaagccgttgatgaaggcaccatcggcaagatcttg
atcggtgaaggcaccgaaaacgtgaaggtcaacagccccatcgcggtgctgcttgaggat
ggcgaaagctacgaccccgatgcggcacccgcagcatccacgccgtccgcaagcgaagcg
ccggcggcagaggcacctgcggcgcccgcaaccgccgccgctgctgccgcagcccccgcc
gcaccggaagtggacaccacccccgactggcccgagggcaccgaggtggtgcagaccacg
gttcgcgaagcgctgcgggacgcgatggctgaagagatgcgcggcgacgaagacgtcttc
ctgatgggcgaagaagtcggcgaatatcagggcgcctataaaatctcgcagggtctgttg
gatgaattcggccccaaacgcgtgatcgacaccccgatcactgaacacggctttgccggc
atcgccaccggtgcggcctttggcggtctgcgtcccattgtggaattcatgaccttcaac
tttgccatgcaggcgattgaccacatcatcaactctgcggccaagacgctgtatatgtcc
ggcggccagatgggcgcgcccatggtgttccgtggtcccaatggagccgctgcccgcgtc
ggcgcccagcactctcaggactacgccgcctggtacatgcagatccccggcctgaaggtg
gcgatgccctactccgcctccgacgccaaaggtctgatgaaaaccgcaatccgcgacaac
aacccggtgatcttcctcgagaacgagatcctctacggcaaatcctttgatgtgccgaag
ctggatgattacaccgttccctttggcaaggcccggatctggcgcaagggcgaggatgtc
accatcgtctccttcggcatcggcatgacctatgcgctggaagcggcggaaaaactggcc
gaggagggtatcagcgccgaggtcattgacctgcgcaccctgcgcccgatggacaccggc
tccatcatcaaatcggtgatgaagaccaaccgtctggtcactgttgaggaaggctggccg
cagggctctgttggcagctatatctcctctgtggtgatgcaggaggcgtttgattacctc
gatgcccccgtcatcacctgcaccggcaaggacgtgcccatgccctatgccgccaatctc
gaaaaacacgcgctggtcaccaccgatgaggtgatcgaagccgtgaaacaagtgacctac
cggtaa

DBGET integrated database retrieval system