KEGG   Phaeobacter porticola: PhaeoP97_01778Help
Entry
PhaeoP97_01778    CDS       T04595                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
php  Phaeobacter porticola
Pathway
php00010  Glycolysis / Gluconeogenesis
php00020  Citrate cycle (TCA cycle)
php00620  Pyruvate metabolism
php01100  Metabolic pathways
php01110  Biosynthesis of secondary metabolites
php01120  Microbial metabolism in diverse environments
php01130  Biosynthesis of antibiotics
php01200  Carbon metabolism
Module
php_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:php00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PhaeoP97_01778 (pdhC)
   00020 Citrate cycle (TCA cycle)
    PhaeoP97_01778 (pdhC)
   00620 Pyruvate metabolism
    PhaeoP97_01778 (pdhC)
Enzymes [BR:php01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PhaeoP97_01778 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: APG47191
UniProt: A0A1L3I579
LinkDB All DBs
Position
1834233..1835543
Genome map
AA seq 436 aa AA seqDB search
MPTEILMPALSPTMEEGTLAKWLVKEGDTVASGDLLAEIETDKATMEFEAVDEGTIGKIL
IPEGSEGVKVNSPIAVLLEEGESADDIAATPDAPAAAANKAAPAASEEAASAPAQATTAA
TPAPAAPQGADGNRIFASPLARRIAADKGLDLSQLSGSGPRGRIVKADVENAKPQAAAAP
ATAAASAAAAAPTGPSADQVARMYEGRTYEEVKLDGMRKTIAARLTEAKQTVPHFYLRRD
IQLDALLKFRGELNKQLEARGVKLSVNDFIIKACALALQAVPDANAVWAGDRVLKMEASD
VAVAVAIEGGLFTPVLQNSDTKSLSTLSTEMKDLAKRARDRKLAPHEYQGGSFAISNLGM
FGIDNFDAIVNPPHAGILAVGAGVKKPVVGADGELAVATVMSVTMSVDHRVIDGALGAEL
LNAIKDNLENPMMMLA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcccacagaaatcctgatgcccgccctctctcccacgatggaggaaggcacgctcgcc
aaatggctcgtgaaggaaggcgacactgtcgcctccggcgaccttctggcggaaatcgaa
accgacaaggcgacgatggaatttgaggccgtcgacgaaggcaccatcggcaagatcctg
atccccgaaggctctgaaggcgtgaaggtcaacagccccatcgccgtgctgctggaagag
ggcgaaagcgccgatgacatcgccgccacaccggatgcccccgctgccgcggcaaacaag
gccgcccccgcagcgtccgaggaagctgcttccgcgccagctcaggccaccacggcggca
acaccagcgcccgccgccccgcagggcgccgatggcaaccgcatctttgcgtcccccttg
gcgcgccgtatcgcggctgacaaggggttggatctctcccagctgagcggttccggcccc
cgtggccgcatcgtgaaggccgacgtggaaaatgccaaaccccaggccgccgccgctccg
gcaaccgccgcagcctctgccgcagctgccgcccccacaggcccctctgccgatcaggtc
gcccgtatgtacgaaggccgcacctatgaggaggttaaactggacggcatgcgcaagacc
atcgccgcccgcctcaccgaggccaagcagacggtgccgcatttctacctgcgccgcgac
atccagctggatgcgctgctgaagttccgcggtgagttgaacaagcagctggaagcccgt
ggcgtcaaactctcggtcaatgacttcatcattaaggcctgcgccctggcgctgcaggcc
gtgccggacgcaaacgcggtctgggccggggaccgcgtgctgaagatggaagcctccgat
gtggcggtcgccgtcgcgattgagggcggattgttcacgcccgtcctgcaaaacagcgac
accaaatcgctctcgaccctgtcgaccgagatgaaggacctcgccaaacgcgcccgtgac
cgcaagcttgcgccgcatgaatatcagggtggcagctttgcgatctccaacctcggcatg
ttcggcatcgacaatttcgacgccatcgtgaacccgccgcacgcaggcatccttgccgtc
ggcgccggggtcaaaaaaccggttgtgggtgcggacggcgaactggccgtggccaccgtc
atgtcagtgaccatgtccgtcgaccaccgcgtcatcgacggcgcccttggcgcggaactc
ttgaacgcgatcaaggacaatctggaaaacccgatgatgatgctggcctga

DBGET integrated database retrieval system