KEGG   Phaeobacter porticola: PhaeoP97_02338Help
Entry
PhaeoP97_02338    CDS       T04595                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase Tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
php  Phaeobacter porticola
Pathway
php00240  Pyrimidine metabolism
php01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:php00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PhaeoP97_02338 (tdk)
Enzymes [BR:php01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     PhaeoP97_02338 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: APG47732
UniProt: A0A1L3I6T2
LinkDB All DBs
Position
2405580..2406179
Genome map
AA seq 199 aa AA seqDB search
MAKLYFHYSTMNAGKSTVLLQASHNYRENDMDTYLLTAALDDRAGQGRIASRIGIGAEAD
MFGPSEDLFAKVSARLDKGDVASIFVDEAQFLSPDQVWQLARVVDDLRVPVLCYGLRVDF
QGKLFPGSATLLALADEMREVRTICHCGKKATMVIRQDESGQTIKEGAQVQIGGNETYLS
LCRRHWRKAMGDVPTDPSS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctaagctttactttcattattcgactatgaacgccggcaaatcgacggtgcttttg
caagcctcgcataactaccgcgagaacgacatggacacctatcttctgacggcagcgcta
gatgatcgcgcgggtcagggtcggatcgcctcacggatcggcatcggtgccgaggcagac
atgttcggcccaagcgaagatctctttgccaaggtctctgcgcgactagacaaaggcgac
gttgccagcatctttgtggatgaggcgcagttcctgtctcccgatcaggtctggcaactg
gcgcgggtcgtcgatgatctgcgagtgccggttctctgctacggactgcgggtagatttt
cagggcaaactgtttcccggctctgccacattgctggcgttggccgatgaaatgcgcgaa
gtgcggaccatctgccactgcggaaaaaaggcaaccatggtgatccgtcaggatgaaagc
ggacagaccatcaaagagggcgcacaggtgcagatcggcggcaatgaaacctatctgtcc
ctctgccgtcgccattggcgcaaagccatgggcgatgtgcctaccgacccgtcgtcctga

DBGET integrated database retrieval system