KEGG   Phaeobacter porticola: PhaeoP97_02980Help
Entry
PhaeoP97_02980    CDS       T04595                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
php  Phaeobacter porticola
Pathway
php00020  Citrate cycle (TCA cycle)
php00190  Oxidative phosphorylation
php00650  Butanoate metabolism
php01100  Metabolic pathways
php01110  Biosynthesis of secondary metabolites
php01120  Microbial metabolism in diverse environments
php01130  Biosynthesis of antibiotics
php01200  Carbon metabolism
Module
php_M00009  Citrate cycle (TCA cycle, Krebs cycle)
php_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
php_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:php00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PhaeoP97_02980 (sdhA)
   00650 Butanoate metabolism
    PhaeoP97_02980 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PhaeoP97_02980 (sdhA)
Enzymes [BR:php01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PhaeoP97_02980 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     PhaeoP97_02980 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO FAD_oxidored GMC_oxred_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: APG48355
UniProt: A0A1L3I8J7
LinkDB All DBs
Position
complement(3082621..3084429)
Genome map
AA seq 602 aa AA seqDB search
MTAAYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAAS
LSNMGPDHWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQ
RPFGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKNNAEFYVEYFAIDLIMSDEG
QCQGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQD
MEFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPQYKDLAPRDYVSRSMTM
EIREGRGVGEHGDHIHLNLSHLPSEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYN
MGGIPTNYWGEVLNPTADDPTAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAA
IRAGKVVDAGSANPVLNQSQIDKAFDRFDGLRHAKGSISTADLRLEMQRTMQGDAAVFRT
SETMAEGVTKMTAIAAKLDDLAVTDRSLVWNSDLMETLELTNLMPNALATIVGAEAREES
RGAHAHEDFTTRDDEKWRVHTVSRVDGNKVDLTYRPVITDRLTTEAEGGISEQKIAPKAR
TF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagcatatgaatatgaaacccacgaatacgacgtcgttgttgtaggcgcaggc
ggtgcaggtttgcgggcgacgcttggcatggcggaacaggggctgcgaaccgcctgtgtg
accaaggtgttcccaacccgctctcacactgtggcggcgcagggtggcatcgcggcatcg
ctttccaacatgggcccggatcactggcagtggcacatgtatgacaccgtcaaaggttct
gactggctgggcgacaccgatgcgatggaatatttggcccgtgaagcgccgaaagcggtt
tatgagttggagcactatggcgtgccgttctcgcggaccgaagaaggcaagatctaccag
cgtccgtttggtggccacaccacagagtttggcgaaggccccgctgtacagcggacctgt
gcggccgccgaccggaccggccatgcgatcctgcacacgctttacggacagtcgctgaag
aacaatgcagagttctatgtcgagtatttcgccatcgacctgatcatgtccgatgaaggt
cagtgccagggtgtagtctgttggaaactggatgacggcactatgcatgtcttcaacgcc
aagatggtggtgctggcgacgggtggttatggccgtgcttatttttccgcgacctctgcg
catacctgcaccggtgacggtggcggcatggtggcccgcgcaggccttgcattgcaggat
atggaatttgttcagttccacccgaccggcatctatggctcaggctgcttgatcaccgaa
ggcgcgcgcggcgaaggcggatatctgaccaactccgaaggcgaacggtttatggagcgc
tatgcgccccagtataaggatctggcgccgcgtgactatgtttcgcgttcgatgaccatg
gaaatccgcgaagggcgcggcgtcggggagcatggtgatcacattcacctgaacctcagc
cacctaccatccgaagcgctggcggaacggctgccggggatttcggagtctgcaaagatc
ttcgccggtgtggatgtgaccaaggagccgatcccggttctgccgaccgtccactacaac
atgggcggtatccccaccaactactggggggaggtgctgaacccaaccgccgatgatcca
accgctgtggtgccaggcctcatggccgtgggcgaggctggctgtgcttcggttcatggt
gccaaccgtctgggctccaactcgttgattgaccttgtggtctttggccgtgcagctgca
attcgtgcgggtaaggttgtggacgccggcagtgccaatccggtgctgaaccagtcccag
atcgacaaggcctttgatcgtttcgacgggctgcgtcatgctaagggcagtatctcaacc
gcagatctacgccttgaaatgcagcgcacgatgcagggcgacgcagcggtgttccggacg
tcggagactatggccgaaggggtgaccaagatgaccgcaattgcggccaaattagacgac
cttgctgtgacagaccgttcgctggtctggaactcggacctgatggaaacgctggagctg
accaacctgatgcccaacgcgttggcaaccatcgtcggtgccgaggcgcgcgaggaaagc
cgtggcgcccatgcgcatgaggattttacaacccgcgacgatgaaaaatggcgtgttcac
accgtgagccgtgttgatgggaataaggtggatctgacctatcgcccagtcataaccgat
cgtctcaccaccgaggcagagggtggtatcagcgaacagaagatcgcgcccaaggcacgg
actttctaa

DBGET integrated database retrieval system