KEGG   Phaeobacter sp. LSS9: D1820_00685Help
Entry
D1820_00685       CDS       T05617                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
phq  Phaeobacter sp. LSS9
Pathway
phq00970  Aminoacyl-tRNA biosynthesis
phq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D1820_00685
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:phq03029]
    D1820_00685
Enzymes [BR:phq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     D1820_00685
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     D1820_00685
Mitochondrial biogenesis [BR:phq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    D1820_00685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey FimA
Motif
Other DBs
NCBI-ProteinID: AXT33600
LinkDB All DBs
Position
complement(137527..139041)
Genome map
AA seq 504 aa AA seqDB search
MLDLTYELPKPKVIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVAFVDA
AMPGMLPVINDYCVEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GEVLVELGDGTARMVRVERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVSRPDIRG
PEEAAAYIAKLRQIMQYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTRC
EIKNMNSMRFIQQAIDVEARRQIAIIEAGGTIDQETRLYDPDKGETRSMRSKEEAHDYRY
FPDPDLLPLEIEQAWVDDIAANLPELPDEKKARFIKDFGLSDYDASVLTADVESATFFEE
TAKGRSGKLAANWVINELFGRLKKDEDKQITDSPVSPAQLGGIIDLISSDAISGKIAKDL
FEIVYTEGGDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLAGWFVGQ
VMKATGGKANPKAVNELVAKKLGE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacctgacatatgaactccccaagcccaaagtgatcgcgggcgccaagcatgac
tgggaactggtcatcggcatggaggtgcatgcccaggtcagctccaatgccaagctgttc
tccggcgcctccaccaagttcggggccgagccaaactccaacgtggcatttgttgatgcc
gccatgcccggcatgctgccggtgatcaacgactactgcgttgaacaggcggtgcgcacc
gggctggggctgaaggccgatatcaacctgtggtccgcctttgaccgcaagaattatttc
taccccgacctgccgcagggctaccagatttcgcagctctatcaccccatcgtgggcgag
ggcgaagtgctggtggaactgggcgacggcaccgcgcgcatggtacgggttgagcggatc
catatggaacaggacgcgggcaagtcgatccacgacatggaccccaacatgtccttcgtc
gacctcaaccgcaccggcgtctgcctgatggagatcgtctcccgccccgacatccgcggg
cccgaggaagcggccgcctatatcgccaagctgcgccagatcatgcagtatctgggcacc
tgcgacggcaatatgcaaaacggcaacctgcgcgccgacgtgaacgtctctgtctgccgt
ccgggccagtatgagaagtatcaggaaacccaggacttctcccacctcggcacccgctgc
gagatcaagaacatgaactccatgcgcttcatccagcaggccatcgacgtcgaggcccgc
cgccagatcgccatcatcgaggcgggcggcaccatcgaccaggaaacccgcctgtacgat
ccggacaagggcgaaacccgttccatgcgctccaaggaagaagcgcatgactaccgctat
ttccccgacccggatctgctgccgctggaaatcgaacaggcttgggtcgatgatatcgcc
gccaacctgccggaactgccggacgagaaaaaggcacgtttcatcaaggatttcggtctg
tccgactatgacgcatcggtgctgaccgccgacgtggaatcggccaccttctttgaggaa
accgctaagggccgcagcggcaaactggccgccaactgggtgatcaacgagctgttcggc
cgcctgaagaaggacgaggacaaacagatcaccgacagcccggtctccccggcgcagctc
ggcggcatcattgacctgatttcttccgatgcgatttccggcaaaatcgccaaggacctg
ttcgagatcgtctataccgaaggtggcgacccggcgcagatcgtcgaagagcgcggcatg
aagcaggtgacagataccggcgccatcgaggccgcgctggacgagatcatcgcagccaac
cccgcacaggtggagaaggccaaggtgaaccccaagctcgcaggctggttcgtcggccag
gtgatgaaagccaccggcggcaaggccaaccccaaggcagtgaatgagctggtggccaag
aaactgggcgagtga

DBGET integrated database retrieval system