KEGG   Phaeobacter sp. LSS9: D1820_07220Help
Entry
D1820_07220       CDS       T05617                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
phq  Phaeobacter sp. LSS9
Pathway
phq00240  Pyrimidine metabolism
phq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    D1820_07220
Enzymes [BR:phq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     D1820_07220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AXT34781
LinkDB All DBs
Position
1517176..1517775
Genome map
AA seq 199 aa AA seqDB search
MAKLYFHYSTMNAGKSTVLLQASHNYRENNMDTYLLTAALDDRAGQGQIASRIGIGAEAD
MFRPGENLFDKVANRLSTGPVASIFVDEAQFLSPDQVWDLARVVDDLRVPVLCYGLRVDF
QGKLFPGSATLLALADEMREVRTICHCGKKATMVIRQDDQGRTITEGAQVQIGGNETYVS
LCRRHWRQATGDLPAETSD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttactttcattactccaccatgaatgccggcaaatcgacggtgctcttg
caagcctcgcataactaccgcgagaacaatatggacacctatctgctgactgcggcgttg
gatgaccgcgccggtcaggggcagattgcctcccgcatcgggatcggcgccgaggcggat
atgtttcgccctggcgagaacctgtttgacaaggtggccaaccgtctgtcgacgggcccg
gtcgccagtatctttgtcgatgaagcgcagtttctgtcgccggatcaggtctgggatctg
gcacgggtggtggatgatctgcgggtgccggtgctgtgctacgggctcagggtcgatttt
cagggcaagctgtttccgggatcggcgacgctgctggcgctggctgatgaaatgcgcgag
gtgcgcaccatctgtcactgcggcaagaaggcaaccatggtgatccggcaggatgatcag
gggcggaccatcaccgaaggggcccaggtgcagatcggcggcaatgaaacatatgtgtcg
ctctgccgtcgccactggcgacaggccacgggcgacctgcctgcggagacgtctgactga

DBGET integrated database retrieval system