KEGG   Phreatobacter sp. S-12: C6569_00565Help
Entry
C6569_00565       CDS       T05356                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
phr  Phreatobacter sp. S-12
Pathway
phr00473  D-Alanine metabolism
phr00550  Peptidoglycan biosynthesis
phr01100  Metabolic pathways
phr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:phr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C6569_00565
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C6569_00565
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    C6569_00565
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:phr01011]
    C6569_00565
Enzymes [BR:phr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C6569_00565
Peptidoglycan biosynthesis and degradation proteins [BR:phr01011]
 Precursor biosynthesis
  Amino acid ligase
   C6569_00565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AVO43693
UniProt: A0A2S0N6Y0
LinkDB All DBs
Position
112360..113283
Genome map
AA seq 307 aa AA seqDB search
MTKPHVAVLYGGWSAEREVSLASGTACADALESRGYRVTRVDVGRDIALRLAELKPDVAL
NVTHGRPGEDGTLAGILEVMQIPYSHSGVMASALCMDKAMAKKVMAAAGVPVPGGLIVPR
REAAREHLLPRPYVIKPNTDGSSLGVFIVTKDHEHPPQELHSTEWTLGDSVLVEPFIAGK
ELTCAVMGDRALGVIEITFAGTFYDYEAKYAPGGSKHLIPAPLKPNIYSEVQRLSLAAHQ
ALGCKGVSRADFRYDDTPGGTGQLVCLEVNTQPGMTGTSLVPDMAAHEGVSFAELVEWMV
LDASLDR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaccccatgtcgccgtcctctatggcggctggtccgccgagcgcgaggtctcg
cttgcctccggcaccgcctgcgccgacgcgctggagagccgcggctaccgggtgacccgc
gtcgacgtcggccgtgacatcgcgctccgcctggccgagctgaagccggacgtggcgctg
aacgtcacccatggccgccccggcgaggacggcacgctcgccggcatcctcgaggtgatg
cagatcccctacagccattccggcgtcatggcctcggcgctatgcatggacaaggcgatg
gccaagaaggtcatggcggcggccggcgttcccgtgccgggagggctcatcgtgccgcgc
cgcgaggccgcccgcgagcacctcctgccgcgcccctacgtgatcaagcccaacaccgac
ggctcatccctcggcgtcttcatcgtcaccaaggaccacgaacatccgccccaggaactg
cactccaccgagtggacgctcggcgactcggtgctggtcgaacccttcatcgccggcaag
gaattgacctgcgcggtaatgggtgaccgcgccctcggcgtcatcgagatcaccttcgcc
ggaaccttctacgactacgaggcgaaatatgccccgggggggtccaagcacctgattccg
gcgccgcttaaaccaaatatttactctgaggttcaaagactgtccctcgcagcgcatcag
gcgctcggctgtaaaggggtcagccgtgcggacttcagatacgacgatacgcccggcgga
accgggcagctcgtctgcctcgaagtcaacacgcagcccgggatgaccgggacttcgctc
gtccccgacatggccgctcacgaaggtgtctcgttcgccgagctggtcgaatggatggta
ttggacgcgtctctcgatcgttga

DBGET integrated database retrieval system