KEGG   Phreatobacter cathodiphilus: C6569_03825Help
Entry
C6569_03825       CDS       T05356                                 

Definition
(GenBank) glutathione S-transferase
Organism
phr  Phreatobacter cathodiphilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_5
Motif
Other DBs
NCBI-ProteinID: AVO44264
UniProt: A0A2S0N7Y4
LinkDB All DBs
Position
772451..773062
Genome map
AA seq 203 aa AA seqDB search
MKLYDTPLAPNPRRVRVFLAEKGIDIPKVTIDLGKMEQKSESYAAVNPRQRTPALELDDG
SVLCESIAICRYIEALHPEPNLFGRTPKEIGEIEMWSRRAELNLLATIASAFRHLHPAMA
AMEVPQVREWGEVNKGRIVDELAFLDRQLKGRDFVCCDRFTNADITAMIGVDFLKPTRVA
VPDELVDLKRWHAAMAARPSAKA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctacgacactccgctcgcccccaatcccaggcgcgtccgcgtcttcctggcg
gagaagggcatcgacattcccaaggtgaccatcgacctcggcaagatggagcagaagtcg
gagagctacgccgcggtcaatccgcgccagcgcacgcccgccctggagctcgacgacggc
tcggtcctgtgcgagtccatcgccatctgccgctacatcgaggcgctccatcccgagccc
aacctgttcggccgcacgcccaaggagatcggcgagatcgaaatgtggtcgcgccgggcg
gagctgaacctgctcgccaccatcgcctccgccttccgccacctccacccggccatggcc
gccatggaggtcccgcaggtcagggaatggggcgaggtgaacaagggccgcatcgtcgac
gagctggccttccttgaccgccagctcaagggacgcgacttcgtctgctgcgaccgcttc
accaatgccgacatcaccgcgatgatcggcgtcgacttcctcaagccgacccgtgtcgcc
gtgccggacgaactggtcgacctgaagcgctggcatgccgccatggctgcccggcccagc
gccaaagcgtga

DBGET integrated database retrieval system