KEGG   Phreatobacter sp. S-12: C6569_09885Help
Entry
C6569_09885       CDS       T05356                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
phr  Phreatobacter sp. S-12
Pathway
phr00970  Aminoacyl-tRNA biosynthesis
phr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C6569_09885 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:phr03029]
    C6569_09885 (gatB)
Enzymes [BR:phr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     C6569_09885 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     C6569_09885 (gatB)
Mitochondrial biogenesis [BR:phr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C6569_09885 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: AVO45343
UniProt: A0A2S0NBM6
LinkDB All DBs
Position
complement(2028129..2029598)
Genome map
AA seq 489 aa AA seqDB search
MTAHANPKNLIPGATGDWEVVIGLEIHAQVASNAKLFSGAAVGFGAPENSQVSLVDAAMP
GMLPVINEECVRQAIRTGLGLKAKINHRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEV
IVDLSPTESFKVGIERLHLEQDAGKSIHDQHPTLSYIDLNRSGTALMEIVSKPDMRSADE
AKAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRRPGEPFGTRCEIKNVNSIRFIGQA
VDYEARRQIGIIEDGGTIDQETRLYDATKGETRSMRSKEEAHDYRYFPDPDLLPLEFSQA
YVDDLAAVLPELPDAKKARLIADYGLTPYDASILVLEKESADYFEAVAKGRDGKSAANWV
INELFGRLNKEGKDVTASPVSPDQIGGIIDLIQAGTISGKIAKDLFEIVFTEGGDPAAIV
EARGMKQVTDTGAIEKVIDEVIAANPDKVEQAKAKPTMLGWFVGQVMKASGGKANPEAVN
AMLKAKLGI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcacgccaatccgaagaacctcatccccggcgccaccggcgactgggaggtg
gtgatcggcctcgagatccatgcccaggtggcgtccaacgccaagctgttctcgggcgcg
gcggtcggcttcggtgcgccggaaaacagccaggtcagcctcgtcgacgcggccatgccg
ggcatgctgccggtgatcaacgaggaatgcgtgcgccaggcgatccgcaccggcctcggc
ctcaaggcgaagatcaaccaccgctcggtcttcgaccggaagaactacttctacccggac
ctgccgcagggctaccagatcagccagtacaagagcccgatcgtcggtgagggcgaggtc
atcgtcgatctgtcgccgaccgaaagcttcaaggtcggcatcgagcgcctgcatctcgaa
caggacgccggcaagtcgatccacgaccagcaccccaccctgtcctatatcgacctcaac
cgctcgggaacggcgctgatggagatcgtctccaagccggacatgcgctcggccgacgag
gccaaggcctatgtgaccaagctgcgcaccatcctgcgctatctcggcacctgcgacggc
gacatggagaaggggaacctgcgcgccgacgtcaacgtctccgtgcgccggccgggcgag
cccttcggcacgcgctgcgagatcaagaacgtcaactcgatccgcttcatcggccaggcc
gtggactacgaggcgcgccgccagatcggcatcatcgaggacggcggcacgatcgaccag
gagacgcgcctctacgacgcgaccaagggcgagacgcgttccatgcgctcgaaggaagag
gcgcacgactaccgctacttccccgatccggacctgctgccgctcgaattcagccaggcc
tatgtggacgacctcgccgcggtgctgccggagcttcccgacgccaagaaggcccgcctc
atcgccgactacggcctgacgccctacgacgcctccatcctggtgctggagaaggagagc
gccgactatttcgaggcggtggccaagggccgtgacggcaagagcgccgccaactgggtc
atcaacgagctgttcggccgcctcaacaaggagggcaaggacgtcaccgcctcgcccgtc
tcgcccgaccagatcggcggcatcatcgacctgatccaggccggcaccatctccggcaag
atcgccaaggacctgttcgagatcgtcttcaccgagggcggcgaccccgcggccatcgtc
gaggcgcgcggcatgaagcaggtcaccgacaccggcgccatcgagaaggtcatcgacgag
gtcatcgccgccaatcccgacaaggtcgagcaggccaaggcgaagcccaccatgctcggc
tggttcgtcggccaggtgatgaaggcgtccggcggcaaggccaatccggaagccgtcaat
gccatgctgaaggcgaagctcgggatctga

DBGET integrated database retrieval system