KEGG   Phreatobacter sp. S-12: C6569_17535Help
Entry
C6569_17535       CDS       T05356                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
phr  Phreatobacter sp. S-12
Brite
KEGG Orthology (KO) [BR:phr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C6569_17535
Enzymes [BR:phr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     C6569_17535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 Methyltransf_11 AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AVO46721
UniProt: A0A2S0NFK7
LinkDB All DBs
Position
complement(3660947..3661981)
Genome map
AA seq 344 aa AA seqDB search
MKALVIHAPHDLRLEEREVAPLRPGEVAVRIGAGGICGSDLHYFHNGGFGAVRLKEPMIL
GHEIAGTVERVGAEVASVKPGDRVAVSPSRPCGHCRYCLEGMANHCLNMRFYGSAMPFPH
IQGAFREVLVCDAVQAHRVAEGVSLGEAAFCEPLAVCLHAARRAGPLLGKRVLVTGCGPI
GALCILAARAAGAAEVVATDVAEATLAVVKGMGVATTLNTAADPEALRPYEADKGSFDVL
FEASGNMKALTGALAALKPGAVIVQVGTGGDFTLPISVLVAKELELRGTFRFHHEFATAV
AMIGERRIDVRPLLTATLPMERAVEAFHLASDRSKAMKVQIAFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctcgtcatccatgccccccacgacctgaggctcgaggagcgcgaggtcgcc
cccctccggccgggcgaggtcgcggtcaggatcggggcgggcggcatctgcggctccgac
ctgcactatttccacaacggagggttcggcgcggtgcgcctcaaggagccgatgatcctc
ggccacgagatcgccggcaccgtggagcgggtcggggcggaggtcgcctcggtgaagccg
ggcgatcgtgtcgccgtgagcccgtcgcggccctgcggccattgccgctactgtctggag
ggcatggccaaccactgcctgaacatgcgcttctacggctcggccatgccctttccgcac
atccagggagcgttccgcgaggtgctggtctgcgacgccgtccaggcgcacagggtggcg
gagggggtgagcctgggggaggccgccttctgcgagccgctggcggtctgcctccacgcc
gcgcggcgggcggggccgctgctcggcaagcgcgttctcgtcaccggctgcgggccgatc
ggggcgctctgcattctcgccgcgcgagcggcgggcgcggccgaggtggtcgccaccgac
gtcgccgaggcgacgctggcggtggtgaagggcatgggcgtcgcgacgacgctgaacacg
gccgccgatcccgaagcgctcagaccctacgaggcggacaagggcagcttcgacgtgctg
ttcgaggcctccggcaacatgaaggcgctcaccggggcgctcgccgccctgaagccgggc
gccgtcatcgtccaggtcggcacgggcggcgacttcaccctgcccatctcggtgctggtg
gccaaggagctggagctgcgcggcacgttccgcttccaccacgagttcgccaccgccgtg
gcgatgatcggcgagcggcgcatcgacgtgcgcccgctgctcaccgcgacgctgccgatg
gagcgggcggtggaggccttccacctcgcctccgaccgttcgaaggcgatgaaggtgcag
atcgccttcgggtga

DBGET integrated database retrieval system