KEGG   Phreatobacter sp. S-12: C6569_19370Help
Entry
C6569_19370       CDS       T05356                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
phr  Phreatobacter sp. S-12
Pathway
phr00564  Glycerophospholipid metabolism
phr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C6569_19370
Enzymes [BR:phr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C6569_19370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AVO47040
UniProt: A0A2S0NFT8
LinkDB All DBs
Position
4036510..4038009
Genome map
AA seq 499 aa AA seqDB search
MTETTVDLLVVGGGINGAGIARDAAGRGASVMLVEQDDLASATSSWSTKLIHGGLRYLEH
YEFRLVREALIEREVLWAIAPHIIRPLRFVLPHHEGLRPAWLLRLGLFLYDHLGGRKRLW
PTRTLDLSADPAGKPLKAGYGKAFEYSDCRVDDSRLVVLNARDAADRGALIRTRTRAVAA
RREGGLWHVTLEDRLHGGTETVAARALVNAAGPWVESFLTGAAKTTPPARVRLVQGSHIV
VRRLFDHDRAYIFQNADNRIIFAIPYERDFTLIGTTDQDYAGDPAAVKASEAEIAYLCAA
ASEYFRDPVTPADVVWTYSGVRPLYDDGASAAQEATRDYVLNKDGGGNVPPLLSVFGGKI
TTYRRLAIGALAELAADLPALRGKADWTAAAPLPGGDIDLDAPVAAGESLWRSHPFLDPA
VAARLAAAYGTRAGRILAGAASMADLGRDFGGGLTEAEIAYLRREEWAVTAEDVLWRRSK
LGLHLDAEQRAAVAAHIGG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacgacggtcgaccttctggtggtcggcggagggatcaacggggcgggcatc
gcccgcgacgccgccggacgcggtgcttcggtgatgctggtggagcaggacgacctcgcc
agcgccacctcctcctggtccaccaagctgatccatggcggcctgcgctatctcgagcac
tacgagttccgcctggtgcgcgaggcgctcatcgagcgcgaggtgctctgggccatcgcg
ccgcacatcatccggccgctgcgcttcgtgctgccgcaccacgagggcctgcggccggcc
tggctgctgcgcctcggcctcttcctctacgaccatctcggcggccgcaagcgcctgtgg
ccgacgcgcaccctcgacctctccgcggaccccgccggcaagccgctgaaggcgggctac
ggcaaggccttcgaatattccgactgccgtgtcgacgattcgcgcctcgtcgtgctcaac
gcccgcgacgccgccgaccgcggcgccctcatccgcacccgcacccgggcggtagcggcg
cgccgcgagggcggcctctggcacgttaccctcgaggaccgcctccacggcggcaccgag
accgtcgcggcccgggcgctggtcaacgccgccggtccctgggtcgagagcttcctcacc
ggcgcggccaagaccaccccgccggcgcgggtgcgcctcgtccagggctcgcacatcgtc
gtgcgccggctcttcgatcacgaccgcgcctacatcttccagaacgccgacaaccgcatc
atcttcgccatcccctacgagcgcgacttcacgctgatcggcaccaccgaccaggactat
gcgggcgatcccgcggcggtgaaggcgagcgaggcggagatcgcctatctctgcgccgcg
gcgagcgagtatttccgcgacccggtgacgcccgccgacgtggtctggacctattccggc
gtgcggccgctctatgacgacggcgcctccgccgcccaggaggcgacccgcgactacgtc
ctcaacaaggacggcggcggcaacgtgccgccgctcctctcggtcttcggcggcaagatc
accacctatcgccggcttgccatcggcgccctcgccgaactcgcggcggacctgccggcg
ctccgcggcaaggccgactggacggccgccgcaccgcttcccggcggcgacatcgatctc
gacgcccccgtcgccgccggcgagagcctgtggcgcagccaccccttcctcgaccccgcg
gtggccgcccgcctcgccgccgcctacggcacccgcgccggccgcatcctcgcgggtgcg
gcctccatggccgatctcggccgcgacttcggcggcggcctcaccgaggccgagatcgcc
tacctccggcgcgaggaatgggcggtgaccgccgaggacgtactgtggcggcgctccaag
ctcggtctccatctcgatgcggagcagcgggcggccgtggcggcccatatcggcggatga

DBGET integrated database retrieval system