KEGG   Paraburkholderia hospita: C2L64_00055Help
Entry
C2L64_00055       CDS       T05305                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
phs  Paraburkholderia hospita
Pathway
phs00010  Glycolysis / Gluconeogenesis
phs00620  Pyruvate metabolism
phs01100  Metabolic pathways
phs01110  Biosynthesis of secondary metabolites
phs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:phs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C2L64_00055
   00620 Pyruvate metabolism
    C2L64_00055
Enzymes [BR:phs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     C2L64_00055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AUT66909
UniProt: A0A1H6HU76
LinkDB All DBs
Position
1:complement(11181..12701)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMKFLTTEFPFKKQYANFIGGEWVKPVGGEYFDNISPITGEPFTSIPRSREADIEL
ALDAAHRAKAAWGKTSTTERANILNKIADRMEANLQRLAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGTVRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALA
AGNCVVLKPAEQTPASILVLLELIQDLLPAGVLNVVNGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVLDKDDSFFDKALEGFAMFALNQGEV
CTCPSRVLVEESIYDRFMERAVKRVAAIQQGHPLDSKTMIGAQASREQLEKILSYIDLGK
QEGAQCLIGGEQNKLDGELSKGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKNEEEAL
EIANDTLYGLGAGVWTRDGTRAYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcagagatgaagtttctgacaaccgagttcccgttcaagaagcagtacgcg
aatttcatcggcggtgaatgggtcaagccggttggcggcgagtacttcgacaacatctcg
ccgattacgggcgaaccgttcacgtcgattccgcgttcgcgcgaagccgacatcgaactc
gcgctggacgccgcgcatcgcgcgaaggcggcctggggcaagacatcgaccaccgagcgc
gcgaacatcctcaacaagatcgccgaccgcatggaggcaaacctgcagcgcctcgccgtc
gcggagacgatcgacaatggcaagccgctgcgcgaaacgatggcggcggacattcccctc
gcaatcgatcacttccgctatttcgcgggcaccgtgcgcgcgcaggaaggcggcatttcg
gagatcgatcacgacacggtcgcgtatcacttccatgagccgctcggcgtggtcggtcag
atcattccgtggaacttcccgatcctgatggcgacatggaagctcgcgcccgcgctcgca
gcaggcaattgcgtcgtgctgaagcccgctgaacagacacccgcttcgatcctcgtgctg
ctcgaactgattcaggatctgctgccggcgggcgtgctgaacgtcgtcaatggtttcggt
ctcgaagcgggcaagccgctcgcgtcgaacaagcgcatcgcgaagattgccttcacaggc
gaaacgacgacaggccgcctgatcatgcagtacgcgagccagaacatcattcccgtgacg
ctggagctcggcggcaagagcccgaatatcttcttcgccgacgtgctcgacaaggacgac
agcttcttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaatcagggcgaagtc
tgcacctgcccgtcgcgcgtgctggtcgaagaatcgatttacgaccgcttcatggagcgc
gcggtgaagcgcgtcgcggccatccagcagggacacccgctcgactcgaagacgatgatc
ggcgcacaggcttcgcgggagcaactggaaaagatcctgtcgtacatcgatctcggcaag
caggaaggcgcgcaatgcctgatcggcggcgagcagaacaagctcgacggcgaactctcg
aagggctattacgtgaagccgaccgtgttccgcggtcacaacaagatgcgcatcttccag
gaagaaatcttcggaccggtcgtttccgtcacgacgttcaagaacgaagaagaagcgctg
gagatcgccaatgacacgctgtatggcctcggcgccggcgtctggacgcgcgacggcacg
cgcgcctatcgcttcggccgcgagatccaagcgggccgcgtgtggacgaattgctaccac
gcgtacccggcgcatgcggcgttcggcggctacaagcagtcgggcatcggacgcgagaat
cacaagatgatgctcgatcactatcagcaaacgaagaatctgctggtcagctatagcgac
aaaccgttgggcttcttctga

DBGET integrated database retrieval system