KEGG   Paraburkholderia hospita: C2L64_03130Help
Entry
C2L64_03130       CDS       T05305                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
phs  Paraburkholderia hospita
Pathway
phs00020  Citrate cycle (TCA cycle)
phs00480  Glutathione metabolism
phs01100  Metabolic pathways
phs01110  Biosynthesis of secondary metabolites
phs01120  Microbial metabolism in diverse environments
phs01130  Biosynthesis of antibiotics
phs01200  Carbon metabolism
phs01210  2-Oxocarboxylic acid metabolism
phs01230  Biosynthesis of amino acids
Module
phs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phs_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:phs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2L64_03130
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C2L64_03130
Enzymes [BR:phs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     C2L64_03130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AUT67448
UniProt: A0A1H6NE73
LinkDB All DBs
Position
1:711479..712735
Genome map
AA seq 418 aa AA seqDB search
MAYQHITVPADGDKITVNADFSLNVSDQPIIPYIEGDGTGVDITPVMIKVVDAAVAKAYG
GKKKIHWMEIFAGEKATKVYGPDVWLPEETMQVVKDYIVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPLREPEKVNMVIFRENSEDIYAGIEWPAGSPEAKKVIQF
LREEMGVKKIRFPDSSGIGVKPVSREGTERLVRKAIQYALDHDRRTVTLVHKGNIMKYTE
GAFRDYGYALAQKEFGAELIDGGPWMKVKNPKTGNDVVVKDVIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANMSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADAILKSMEKSILSKRVTYDFARLMEGATQVSCSGFGQVMIDNM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatcagcacatcacggttccggctgacggtgacaagatcactgtcaacgcggat
ttctcgctcaacgtttccgatcagccgatcattccgtacatcgaaggcgacggcacgggc
gtcgacattacgcccgtgatgatcaaggtcgtcgatgcagccgtcgcaaaagcctacggc
ggcaagaagaagatccactggatggaaatcttcgcgggcgagaaggcgaccaaagtttat
ggtcccgacgtgtggctgccggaagaaacgatgcaggtggtgaaggactacatcgtgtcg
atcaaagggccgctcacgacgcccgtcggcggcggcatccgctcgctgaacgtcgcgctg
cgccaggaactggacctctatgtgtgcctgcgccccgtgcagtacttcaaaggcgtgccg
tcgccgctgcgcgagccggagaaggtcaacatggtgatcttccgcgagaactcggaagac
atctacgcgggtatcgaatggccggcgggttcgcccgaggcgaagaaggtcatccagttc
ctgcgcgaagaaatgggcgtgaagaagatccgtttcccggactcgtcgggtatcggcgtg
aagccggtgtcgcgcgaaggcaccgagcgtctggtgcgcaaggcgatccagtatgcgctc
gaccacgatcgccgcacggtcacgctggtgcacaagggcaacatcatgaagtacacggaa
ggcgcattccgtgactacggctatgcgctcgcgcaaaaagagttcggcgccgagctgatc
gatggcggcccgtggatgaaggtgaagaatccgaagacgggcaacgatgtcgtcgtgaag
gatgtgatcgccgatgcgttccttcagcagatcctgctgcgtcccgccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcgctggccgcgcaggttggc
ggcatcggcattgcgccgggcgcgaacatgtcggactccgtcgcgatgttcgaagcgacg
cacggcacggcgccgaagtacgcgggcaaggactatgtgaatccgggttcggagattctt
tcggcggagatgatgctgcgccatctgggctggacggaagcggcggatgcgattctgaag
tcgatggaaaagtcgattctgtcgaagcgtgtcacgtatgacttcgcgcgcctgatggaa
ggcgcgacgcaggtgtcgtgctcgggcttcggtcaggtgatgatcgacaacatgtga

DBGET integrated database retrieval system