KEGG   Paraburkholderia hospita: C2L64_10045Help
Entry
C2L64_10045       CDS       T05305                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
phs  Paraburkholderia hospita
Pathway
phs00020  Citrate cycle (TCA cycle)
phs00310  Lysine degradation
phs00380  Tryptophan metabolism
phs01100  Metabolic pathways
phs01110  Biosynthesis of secondary metabolites
phs01120  Microbial metabolism in diverse environments
phs01130  Biosynthesis of antibiotics
phs01200  Carbon metabolism
Module
phs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:phs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2L64_10045 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    C2L64_10045 (sucA)
   00380 Tryptophan metabolism
    C2L64_10045 (sucA)
Enzymes [BR:phs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     C2L64_10045 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N DUF2680
Motif
Other DBs
NCBI-ProteinID: AUT68623
UniProt: A0A1H6PFH4
LinkDB All DBs
Position
1:complement(2206481..2209336)
Genome map
AA seq 951 aa AA seqDB search
MMKQFQSNSYLFGGNAPYVEELYEAYLDNPASVPETWRNYFDALQNVPASDGTSANDVAH
GPIVESFAQRAKANAFLPRTGGEDLTTARKQVYVQSLIGAYRFLGSQWANLDPLKRRERP
NIPELEPAFYDFTEADMDQTFNTNNLYFGFEQASLRDIVKALRDTYCGTIGAEYMYLSDP
EQKRWWKERLESIRSTPNFTNDKKKHILNRLTAAEGLERFLHTKYVGQKRFSLEGGESFI
ASMDEVVHHAGKSGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAGDVK
YHKGFSSDVATEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDENGLQVLPVQIHG
DAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCSDVVKMIE
APVLHVNGDDPEAVVLATQLAIDFRMQFHKDVVIDIICFRKLGHNEQDTPAVTQPLMYKT
IAKHPGTRALYAEKLVQQGVITADQGDEFIKAFRKAMDEGHHTVDPVLSNYKSKYAVDWV
PFLNRKWTDAADTAVPLAELKRLAERITTIPEGFKVHPLVERVINDRRAMGRGEAKLDWG
MGEHLSFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAEGQA
KFTVIDSVLSEEAVLGFEYGYSTAEPNTFVAWEAQFGDFVNGAQVVIDQFISSGEVKWGR
VSGLTMLLPHGYEGQGPEHSSARIERFLQLCADHNMQVVQPTTPAQVFHLLRRQMIRLFR
KPLVVFTPKSLLRHKEAVSDLSELAKGSFQPVLSETDDSIDAKKVKRVLVCSGRVYYDLL
AHRREAKAQDVAIVRIEQLYPFAHKQFESELKKYDNATEVVWVQDEPQNQGPWFYIEHHL
REGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKGASIVK
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaattccagtcgaactcgtatctgttcggcggcaatgctccgtacgtagaa
gagttgtacgaagcatatctcgacaatcccgcgtcagtgcccgagacctggcgcaattat
ttcgacgctctgcagaacgttcctgcatcggatggcaccagtgccaacgacgtggcccat
ggcccgatcgtcgaatcatttgctcagcgcgcaaaggcgaatgccttcctgccgcgcacg
ggtggtgaggatctcaccaccgcgcgtaagcaggtctatgtgcagtccctcatcggcgca
tatcgcttcctcggctcgcagtgggccaacctcgatccgctgaagcgccgcgaacgtccg
aacattcccgagcttgaacctgcgttctacgacttcaccgaagccgacatggaccagacg
ttcaacacgaacaacctgtacttcggtttcgaacaggcttcgctgcgggacatcgtcaag
gcgttgcgcgacacgtactgcggcacgatcggcgccgagtacatgtacctgagcgatccg
gaacagaagcgctggtggaaggaacgtctcgaatcgatccgctccacgccgaacttcacg
aatgacaaaaagaagcacatcctgaaccgactgacggcagcagaaggcctcgagcgcttc
ctgcacaccaagtacgtcggtcagaagcgcttctcgctggaaggcggcgaaagcttcatc
gcgtcgatggacgaagtcgtgcatcacgcaggcaagagcggcgtgcaggaaatcgtcatc
ggcatggcgcaccgcggccgtctgaacgtgctggtcaacacgctgggcaagatgcccgct
gacctgttcgccgaattcgaaggcaagcacgtcgacgatctgcccgcaggcgatgtgaag
taccacaagggcttctcgtcggatgtcgcaacggaaggcggcccggttcacctgtcgctc
gcgttcaacccgtcgcacctcgaaatcgtcaacccggtggtcgaaggttcggcgaaggcc
cgtatggaccgtcgcggcgacgagaacggcctgcaagtgctgcctgtgcagatccacggc
gacgccgccttcgcaggtcagggcgtcgtgatggaaacgctgaacctcgcgcaaacgcgc
ggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggcttcaccacg
tccgacccgcgcgacgcacgctccacgctgtattgctcggacgtcgtcaagatgatcgag
gcgcccgtgctgcacgtgaacggcgacgatcccgaagcggtcgtgctggctacgcagctg
gccatcgacttccggatgcagttccacaaggatgtcgtgatcgacatcatctgcttccgc
aagctgggtcacaacgagcaggacacgcccgccgtcacgcagccgctgatgtacaagacg
atcgccaagcaccccggcacgcgcgcgctgtacgcggaaaagctggtgcagcaaggcgtc
atcaccgccgatcaaggcgatgaattcatcaaggcattccgcaaggcgatggacgaaggt
caccacacggtcgacccggtcctgtcgaactacaagagcaagtacgccgtcgactgggtt
ccgttcctgaaccgcaagtggacggacgcagccgacacggctgtgccgctcgccgaactc
aagcgtctggccgagcgtatcacgacgatccccgaaggcttcaaggttcacccgctcgtc
gagcgcgtgatcaacgaccgccgtgcaatgggccgtggcgaagcgaagctcgactggggc
atgggcgagcatctgtcattcgcgtcgctggtcgcatcgggttatgccgtgcgcctgacg
ggtcaggactcgggccgtggcacgttcacgcaccgtcacgcagtgctgcacgaccagaac
cgcgaacgctggaacgacggcacgtacgtgccgctgcagaacatcgccgaaggtcaggcg
aagttcacggtgatcgactcggtgctgtccgaagaagccgtgctcggcttcgaatacggc
tactcgacggctgagccgaacacgttcgtcgcgtgggaagcgcagttcggcgacttcgtg
aacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaagtggggccgc
gtgtcgggcctgacgatgctgctgccgcacggctacgaaggccagggtccggagcactcg
tcggcgcgtatcgagcgcttcctgcaactgtgcgcagatcacaacatgcaggtcgtacag
ccgacaacgccggcacaggttttccacctgctgcgccgccagatgatccgcctgttccgc
aagccgctcgtcgtcttcacgccgaagtcgctgctgcgtcacaaggaagccgtgtcggat
ctgtcggaactcgcgaagggctcgttccagccggttctcagcgaaacggacgattcgatc
gatgccaagaaggtcaagcgcgtgctggtctgctcgggccgcgtgtactacgacctgctt
gcgcatcgccgcgaagcgaaggcgcaggacgtcgcgatcgtgcgtatcgaacagctctat
ccgttcgcgcacaagcagttcgaatccgaactgaagaagtacgacaacgcaaccgaagtg
gtgtgggtgcaggacgagccgcagaatcagggcccgtggttctacatcgaacatcacctg
cgcgaaggcatgaaggaaggacagaagctggcatacagcggccgtcccgcttcggcttcg
cccgctgtcggctactacgcgaagcactacgagcagcagaaggcgctgatcgaaggcgcg
tttggccgtctgaaaggcgcgtccatcgttaaataa

DBGET integrated database retrieval system