KEGG   Paraburkholderia hospita: C2L64_19210Help
Entry
C2L64_19210       CDS       T05305                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
phs  Paraburkholderia hospita
Pathway
phs02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:phs00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C2L64_19210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:phs02000]
    C2L64_19210
Transporters [BR:phs02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    C2L64_19210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_22 Mg_chelatase oligo_HPY SMC_N
Motif
Other DBs
NCBI-ProteinID: AUT70527
UniProt: A0A244D982
LinkDB All DBs
Position
2:complement(204536..205417)
Genome map
AA seq 293 aa AA seqDB search
MSTHDTTPALCEIDDLRIAFRTHDGTMNEAVRGLSLTLNKGERLGIVGESGSGKSLTGRA
LLGLLPPAAHCTAKTMRFDGSDLLDMRADKRRKLCGQQMGMILQDPKYSLNPVMTVAQQM
REAFALHEPKLGRRAMREKIIAALEAVHIRNPERVVDSYPHELSGGMGQRVMIAMMVSTG
PRLLIADEPTSALDVLVSMQVLAVLDEMIAKHDTGLIFISHDLPLVMSFCDRVVVMYAGR
VVETCAARDLVHAQHPYTRGLLAANPPLANPPAELPVLSRDPAWLNDVQGASA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcacgacacgacgcccgcattgtgcgaaatcgacgatctgcgcattgcgttc
cgcacgcacgacggcacgatgaacgaagcggtgcgtggtctttcgctgacgctgaacaag
ggcgagcggcttggcattgtcggcgagtccgggtcgggtaaatcgttgacgggtcgcgcg
ctgctgggattgttgccgcccgccgcgcattgcacggccaagacgatgcgcttcgatgga
agcgatctgctcgacatgcgcgccgacaagcgccggaagttgtgtggccagcagatgggc
atgatcctgcaagacccgaaatactcgctgaacccggtgatgaccgtggcacagcagatg
cgcgaagcgttcgcgctgcacgagccgaagctcggccggcgcgcgatgcgcgagaagatc
atcgccgcgctcgaagccgtgcatattcgcaacccggagcgcgtggtggattcgtatccg
cacgaactctcgggcggcatggggcagcgcgtgatgatcgcgatgatggtatcgacgggg
ccgcgcctgttgatcgccgacgaaccgactagcgcgctcgacgtgttggtatcgatgcag
gtactcgccgtgctcgatgaaatgatcgcgaaacatgatactggcctcatcttcatcagc
cacgatctgccgctcgtgatgtcgttctgcgaccgcgtcgtggtgatgtacgcggggcgc
gtcgtcgaaacctgcgcggcgcgcgatctcgttcatgcgcagcatccgtatacacgcggc
ttgttggcggcgaatccgccgcttgcgaatccgcctgccgagttgcccgttctctcgcgc
gatcccgcatggctcaacgatgtgcaaggagcatccgcatga

DBGET integrated database retrieval system