KEGG   Paraburkholderia hospita: C2L64_21475Help
Entry
C2L64_21475       CDS       T05305                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
phs  Paraburkholderia hospita
Pathway
phs00250  Alanine, aspartate and glutamate metabolism
phs00410  beta-Alanine metabolism
phs00640  Propanoate metabolism
phs00650  Butanoate metabolism
phs01100  Metabolic pathways
phs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:phs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    C2L64_21475
   00650 Butanoate metabolism
    C2L64_21475
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C2L64_21475
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C2L64_21475
Enzymes [BR:phs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C2L64_21475
Amino acid related enzymes [BR:phs01007]
 Aminotransferase (transaminase)
  Class III
   C2L64_21475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUT73002
UniProt: A0A1H6P9V8
LinkDB All DBs
Position
2:complement(672610..673893)
Genome map
AA seq 427 aa AA seqDB search
MKNAELKSRKDAATPRGVGVMCDFYAARAENAELWDVEGRRYIDFAAGIAVCNTGHRHPK
IVEAVRAQLDNFTHTAYQIVPYASYVELAEKINQRAPGDYPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFTGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPFPNPLHGVTTA
DSLKAIEFLFKADIDPKRVAAIIFEPVQGEGGFYPAPAEFVRALRKLCNEHGILLIADEV
QTGFARTGELFAMHHYDVVPDLMTMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASALAVLDIIDEEKLCERAVLLGDRLKARLTALQAEVPQIADVRGPGGMVAVEFCK
PGTSDADADFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTVQDAVFDEALSILEEVLK
ETVGVTV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgctgaactgaagagccgcaaggacgccgccaccccgcgcggcgtgggcgtg
atgtgcgatttctacgctgcgcgcgccgagaatgcggaactgtgggacgtcgagggccgc
cgctacatcgatttcgcggcgggcatcgcggtgtgcaacacggggcatcgtcatccgaag
atcgtcgaggctgtgcgcgcgcaactggacaacttcacgcacacggcttatcagatcgtg
ccgtacgcgtcgtatgtcgagctggctgagaagatcaaccagcgcgcgccgggcgactat
ccgaagaagacggcgttcttcacgacgggcgccgaggctgtcgaaaacgcgatcaagatc
gcgcgcgccgcgacgggccgtccgggtgtgatcgcgttcacgggcggctttcatggccgc
acgatgatgggcatggcgctgacgggcaaggtcgcaccgtacaagctgaacttcggcccg
ttcccgggcgatgtgttccacgcgccgttcccgaatccgctgcacggcgtgacgacggcg
gattcgctgaaggcgatcgaattcctgttcaaggcagacatcgatccgaagcgcgtcgcg
gcgatcattttcgagccggtgcaaggcgaaggcggtttttatccggcgccggccgagttc
gtgcgcgcgctgcgcaagctgtgcaacgagcacggcattctgctgattgctgatgaagtg
caaacggggtttgcgcgtacgggcgagctgtttgcgatgcatcactacgacgtcgtgccc
gatttgatgacgatggccaagagcctggcgggtggcatgccgctgtcgggcgtcgtcgga
cgtgcggatgtgatggatgctgctgcgcccggcgggctgggcggcacgtatgcgggtaat
ccgttggcggtggcttcggcgcttgccgtgctcgatatcatcgatgaagagaagctctgc
gagcgggctgttttgcttggcgatcggttgaaggcgcggctgaccgcgttgcaggcggaa
gtgccgcagattgccgatgtgcgggggccgggcggtatggttgctgttgagttctgtaag
cctggtacttccgatgcggatgctgattttaccaagcgggtgcagacgcgggctcttgag
cgtggtttgttgctgctcgtttgtggggtttattcgaacgttgttcggttcctgttcccg
ctgactgtgcaggatgctgtttttgatgaggcgctttctattcttgaggaagtgctcaag
gaaactgtgggcgtgactgtctga

DBGET integrated database retrieval system