KEGG   Paraburkholderia hospita: C2L64_27945Help
Entry
C2L64_27945       CDS       T05305                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
phs  Paraburkholderia hospita
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh SnoaL_2
Motif
Other DBs
NCBI-ProteinID: AUT72041
UniProt: A0A1H6PII9
LinkDB All DBs
Position
2:complement(2139151..2140620)
Genome map
AA seq 489 aa AA seqDB search
MTEYSTALSSNVRSRFFINGEWVLSHSGARHVLISPATEEPFMSVPLADSVDVERAIAAA
RRAFDSGPWPKLSGAERSGYLKRLTEEIRQRLPLLAQLWTDQVGAPITFANGLLPTGITR
FEFFASLAETFEFEDARPTRRGHARVRREPVGVAALIAPWNATFPIVSHKIAAALAAGCT
VVVKSPPESPLDALIIAECAAAVGLPPGVLNVITAGRDEGAQLVQSRDVDKISFTGSVAT
GQWIARAAVDRLARVTLELGGKSAAILLDDVDLPSALAALTPFTMPFSGQICFAQTRILA
PRARHDEVVSAYAEIISKLKLGDPRETDTRIGPVLNAVQRDRVRGYIEQGISEGAQLVLG
GTGNGGFGKGYFVEPTVFAHVTPDTTIAQQEIFGPVVSILPYDDIDDAVRIANDTPYGLS
GSVYSSDVERAYALACRIQAGHIGINGVELAANVPFGGYKLSGVGREGGREGLEAYLETK
AVFMPTAAG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtactccacagcactttcgtcgaatgtccgcagtcgctttttcatcaatggc
gaatgggtgctgagccactccggcgcgcgccatgtgctgatttctcctgcgacggaagag
cctttcatgtcggttccgctcgcggattccgtggacgtcgagcgtgcgatcgcggcggcg
cgccgcgcatttgacagcggtccgtggccgaagttatcgggcgctgagcgaagcggatat
ctgaagcggctgacggaagaaatccgtcagcgcttgcccttgctcgcgcaactgtggacc
gatcaggtcggcgcgccgattacgtttgcgaatggtctgcttcccacgggtatcacgcgc
ttcgagttctttgcgtcgctcgcagagacgttcgaattcgaggacgcgcgaccgacacgg
cgcggccacgcgcgcgtacgtcgcgaacccgtcggtgtcgccgcattgattgcgccgtgg
aatgcaaccttcccgatcgtgtcgcacaagatcgcggcggcgctggccgcgggttgcacg
gtcgtcgtcaagtcgccgccggagagtccgctcgatgcgctgatcatcgcggaatgcgcg
gcggctgtgggccttccgccgggcgtgctgaatgtcatcacggcgggccgtgacgagggc
gcgcaactggtgcaatcgcgcgatgtcgacaagatcagctttacgggcagcgtcgccacg
gggcagtggatcgcacgcgcggcagtggatcggctggctcgcgtgacgctggaactcggc
gggaaatcggcggcgattctgctcgacgacgtcgatctgccttcggcgctggcagcgctg
acgccgttcacgatgccgttttccggccagatctgcttcgcgcagacgcgcattcttgcg
cccagggcacgacatgacgaggtcgtcagcgcgtacgctgagatcatttcgaagctgaag
cttggcgacccgcgcgagaccgatacgcggatcgggccggtattgaacgcagtgcagcgg
gatcgtgtgcgcggctatatcgagcagggcatcagtgaaggcgcgcagctcgtgttgggc
ggtactggcaatggtggcttcgggaagggctatttcgtcgagcctacggtattcgctcac
gtcacgccggacacgacgattgcgcagcaggagatcttcggcccggtcgtttcgattctt
ccttatgacgacatcgacgacgccgtgcgtatcgcgaacgacacgccgtatggcctgagc
ggctcagtttatagcagcgatgtggagcgggcctacgcgctcgcgtgccgcatccaggca
ggccatatcggcattaacggcgtcgaactggcggccaatgtgccgttcggcggttacaag
ttatcaggagtgggccgcgaaggcggtcgcgagggactggaggcgtacctcgaaaccaag
gcagtgttcatgccgacggcggctggatga

DBGET integrated database retrieval system