KEGG   Paraburkholderia hospita: C2L64_28865Help
Entry
C2L64_28865       CDS       T05305                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
phs  Paraburkholderia hospita
Pathway
phs00061  Fatty acid biosynthesis
phs00780  Biotin metabolism
phs01100  Metabolic pathways
phs01130  Biosynthesis of antibiotics
phs01212  Fatty acid metabolism
Module
phs_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:phs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C2L64_28865
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C2L64_28865
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    C2L64_28865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:phs01004]
    C2L64_28865
Enzymes [BR:phs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     C2L64_28865
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     C2L64_28865
Lipid biosynthesis proteins [BR:phs01004]
 Fatty acid synthase
  Component type
   C2L64_28865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AUT72203
UniProt: A0A1H6MAD7
LinkDB All DBs
Position
2:2334938..2335717
Genome map
AA seq 259 aa AA seqDB search
MDTSTSQVMAQHKVLVIGIANEHSIAYGCARAFRELGAELAITYLNEKAKAYVEPLAQEL
GASLLLPLDVSKPGELEAVFDEIRATWGRLDVAVHSIAFAPKADLQGGLLNSSAEGFSVA
MDISCHSFIRMARLAAPLMDEGGSLFAMSYLGATRVVPNYDLMGPVKAALEASCRYLAHE
LGPKRIRVHPISPGPLKTRAASGLKDFDLLLAEAAERAPIGELVDIMDVGYTCAFLATPY
ARRMTGNTVFVDGGVSIIG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggacacgtcaacgagccaggtgatggcgcaacacaaggtgctggtcatcggcatcgca
aacgagcattcgatcgcgtacggctgcgcgcgcgcattccgcgagcttggcgccgaactc
gcgatcacctatctgaatgagaaggcgaaggcctacgtcgagccgctcgcgcaggaactc
ggcgcgtcactgctgctgccgctcgacgtgtcgaagcccggggaactcgaagcggtgttc
gatgagatccgcgcgacgtggggacggctcgacgtcgccgtgcattcgatcgcgttcgcg
ccgaaggccgatctgcagggcggcctgctgaacagttcggcggaaggcttttcggtggcg
atggacatttcgtgtcattcgttcatccgcatggcgcgcctcgccgcgccgctgatggac
gaaggcggatcgctgttcgcaatgagctatctgggcgcgacgcgcgtcgtgccgaactac
gatctgatggggcccgtgaaggccgcgctcgaagcgtcgtgccggtacctggctcacgaa
ctcggaccgaagcgcatccgcgtgcatcccatttcgccgggaccgctgaagacgcgcgcc
gcgtcgggactgaaggacttcgatctgctgctcgccgaagcggccgagcgagcgcccatc
ggcgaactcgtcgacatcatggacgtcggctacacctgcgcgttcctcgcgacgccctac
gcgcgccgcatgacgggcaacacggtgttcgtcgacggcggcgtgagcatcatcggctga

DBGET integrated database retrieval system