KEGG   Paraburkholderia hospita: C2L64_30760Help
Entry
C2L64_30760       CDS       T05305                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
phs  Paraburkholderia hospita
Pathway
phs00440  Phosphonate and phosphinate metabolism
phs01100  Metabolic pathways
phs01120  Microbial metabolism in diverse environments
phs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:phs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    C2L64_30760 (aepX)
Enzymes [BR:phs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     C2L64_30760 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AUT72531
UniProt: A0A1H6MMU4
LinkDB All DBs
Position
2:complement(2724830..2726539)
Genome map
AA seq 569 aa AA seqDB search
MNAREPSFVSTLSRSARLRQMLTSNELEFLMEAHNGISARIAREAGFKGIWGSGLAISAQ
YGVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCI
EDKVFPKTNSFIKGEAQPLADIDEFCGKIKAGKDSQTDEHFSIVARVEALIAGWGMDEAL
KRAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFRKAGIS
TVIWANHQIRAATSAMQAVVKEIYESQTLVNVEDRIATVNEIFRLQDADEYSVAEERYLS
SSRVAGSAVVLAASRGKGLEAVTTDRPKVMLPIAGKPLLRWLVDAFKQQGVNDITVVGGY
RADAIDTAGIKLVVNERHEQTGELASLACAVDGLQNDTVISYGDLLFRSYIVRDLVDSEA
PFSVVVDSTTVAEAGATNQSVRDFAWCSAGDDRGLFGNKVLLRRVANNEADVKGEVPNGR
WIGLLNVRGAGRERLQAVMNTLRARPDFDSLDMPALLNALIEAGEEIEVQYVHGHWRGVN
DLEDFRRAGDFAHEATPLAKSEAAGGAAQ
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaaccctctttcgtttctactctgtcgcgcagcgcacgactgcgccag
atgctcaccagcaacgagctcgaattcctgatggaagcgcacaacggcatctccgcacgc
attgcgcgcgaagccggcttcaagggcatctggggctcgggcctcgcgatctccgcgcaa
tacggcgtgcgcgacaacaacgaagcgagctggacgcaagttgtcgatacgctcgaattc
atggctgacgcgagcgatctgcctattctgctcgacggcgacaccggctacggcaacttc
aacaacgtgcgccgcctggtgcgcaagctggagcagcgcggtattgcgggcgtctgcatc
gaagacaaggtgttcccgaagacgaacagcttcatcaagggcgaagcgcagccgctcgcc
gatatcgacgagttctgcggcaagatcaaggcgggcaaggactcgcagaccgacgagcat
ttctcgatcgtcgcgcgcgtcgaagcgctgatcgcgggctggggcatggacgaagcgctg
aagcgcgccgaagcgtatcgccaggcgggcgcggacgcgatcctgattcacagcaagctg
tcgcgccccgatgagattctcgaattcgcgcgcgaatgggcaggccgcggtccgctcgta
atcgtgccgaccaagtactacagcacgccgacggaagtgttccgcaaggcgggcatcagc
acggtgatctgggcgaaccatcagattcgtgcggcgacttccgcgatgcaggctgtcgtc
aaggagatctacgaaagccagacgctcgtcaatgtcgaagaccgcattgcgaccgtcaac
gaaatcttccgtttgcaggatgccgacgagtactcggtagcggaagagcgctacctgtcg
tcgtcgcgcgtggcgggttcggctgtggtgctcgccgcgagccgcggcaagggcctcgaa
gccgtgacgacggaccgtccgaaggtcatgctgcccatcgcgggcaagccgctgctgcgt
tggctcgtcgacgcgttcaagcagcagggcgtcaacgacatcacggtcgtgggcggctat
cgcgccgacgcaatcgacacggcgggcatcaagctggtcgtcaacgagcgtcacgaacag
acgggcgaactggcgtcgctcgcgtgcgccgtcgacggcttgcagaacgacaccgtgatt
tcgtacggcgacctgctgttccgcagctacatcgtgcgcgatctggtggacagcgaagcg
ccgttcagcgtggtcgtcgattcgacgacggttgccgaagcgggcgcgacgaaccagagc
gtgcgcgatttcgcgtggtgctcggccggtgacgatcgcggcctgttcggcaacaaggtg
ctgctgcgccgcgtggcgaacaacgaagccgacgtgaagggcgaagtgccgaatggccgc
tggatcggtctgctgaacgtgcgcggcgcgggccgcgagcgtctgcaggccgtgatgaac
acgctgcgcgcgcgccccgatttcgattcgctcgacatgcccgcgctgttgaatgcgctg
atcgaagccggtgaagaaatcgaagtgcaatacgtgcacggccactggcgcggcgtgaac
gacctcgaagacttccgtcgtgcgggcgacttcgcgcacgaagcgacgccgctcgcgaag
agcgaggcagcgggaggcgcggcgcaatga

DBGET integrated database retrieval system