KEGG   Paraburkholderia hospita: C2L64_31785Help
Entry
C2L64_31785       CDS       T05305                                 

Gene name
treS
Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
phs  Paraburkholderia hospita
Pathway
phs00500  Starch and sucrose metabolism
phs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C2L64_31785 (treS)
Enzymes [BR:phs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     C2L64_31785 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     C2L64_31785 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH EcKinase hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AUT72698
UniProt: A0A1H6P244
LinkDB All DBs
Position
2:2937627..2941085
Genome map
AA seq 1152 aa AA seqDB search
MKRDDSAESTSQHFTDTTAEAVPAKPRPSRRAKVSTLADDPLWYKDAIIYQVHIKSFFDA
NNDGVGDFPGLIAKLDYIAELGVSAIWLLPFYPSPRRDDGYDIADYKSVHPDYGSIGDVK
RFIQEAHARGLHVITELVINHTSDQHPWFQRARRAKPGSNHRNYYVWSDTDKKYEKTRII
FIDTEPSNWTHDPVAGQYYWHRFYAHQPDLNFDNPAVLREVLQVMRFWLDLGIDGLRLDA
VPYLVEREGTNNENLPETHAILKKIRATIDAEYPNRMLLAEANQWPEDVQEYFGNEDECH
MAFHFPLMPRIYMSIASEDRFPITDIMKQTPDLPETNQWAIFLRNHDELTLEMVTDSERD
YLWNTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGDN
IHLGDRDGVRTPMQWSSDRNGGFSRADPEQLVLPPVMGSLYGFDAVNVEAQSRDPHSLLN
WTRRMLATRRSKHTFGRGTIRFLKPSNRKILAYLRELPGQPPILCVANLSRAPQAVELDL
SEFNGAVPIEMTADSVFPAIGQLTYLLTFPPYGFLWFLLCEGGGRPTWSQAPSEPLPDFV
TIVIREGQAGPTPENVRLLESEVLPSWLGRRRWYASKDQKLHAVRLAALTTIPEAGFAFT
EIEADVGNHTERYVLPLAITWGADTTTPLFMQLALARVRRGRNVGHLTDAFALPQFAYGT
LRKLRERAAVATFQKSTIHFIPTDRFADLDLGDAPEIRWLAAEQSNSSLVIADKIVLKLV
RRLLKGMHPEAEMSRYLTQLGYANTAPLYGEVVRVDPENVPHTLCILQGFVDNQGDAWNW
ALDTLRRSIDELALAVDGANNENQANQDRVNEEEATEGYASYMGIIGKRLGELHVALATP
SDNPAFDPELADSKQVQAWIDGTQKLLASALELLEKNVDQLGEDAALLGRSVLDRKDKLV
EAVSKLVKPDAHALRTRIHGDFHLGQVLVAQGDAFLIDFEGEPARELEERRAKSSPLRDV
AGLLRSLSYASAAAQSTMEAAPQMTADRKRALFERFRAAAAEAFLTEYRAATQAASQRLV
APEHEQALLDLFLIEKAAYEIRYEAANRPAWLGLPVRGLAALTSRLLGDTGAAPHSPAAA
SAPPAASEGDYE
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgacgattccgccgaaagcacgtcgcagcatttcaccgacacgacagccgag
gccgttccagcgaagccgcgcccgtcgcgccgcgccaaggtgtcgacgctcgccgacgat
ccgctctggtacaaggacgcgatcatctaccaggtgcacatcaagtcgttcttcgatgcg
aacaacgacggcgtcggcgatttccccggcctgatcgcgaagctcgactacatcgcggaa
ctcggcgtcagcgcgatctggctgctgccgttctatccgtcgccgcgccgcgacgacggc
tacgacatcgccgattacaagagcgtgcaccccgactacggctcaattggcgacgtcaaa
cgcttcattcaggaagcgcacgcgcgcggactgcacgtgatcaccgaactcgtcatcaac
cacacgtcggaccagcacccgtggttccagcgcgcgcgccgcgcgaagcccggctcgaat
catcgcaactactacgtatggtccgacacggacaagaagtatgaaaagacacgcatcatc
ttcatcgatactgaaccgtcgaactggacgcatgaccccgtcgcaggccagtactactgg
caccgcttttacgcgcaccagcccgacctgaacttcgacaatcccgctgtgttgcgcgaa
gtgctgcaggtgatgcgcttctggctcgacctgggcatcgacgggttgcggctggatgcc
gtgccgtatctcgtcgagcgcgaaggcacgaacaacgagaatctgcccgaaacgcacgcg
atcctgaagaagattcgcgcgaccatcgacgccgagtatccgaaccggatgctgctcgcc
gaagcgaaccagtggccggaagacgtgcaggaatacttcggcaacgaagacgaatgccat
atggcgttccacttcccgctaatgccgcgcatctacatgtcgattgcgagcgaagaccgc
ttcccgatcaccgacatcatgaaacagacgccggatctccccgagacgaaccaatgggcg
atcttcctgcgcaatcacgatgaactcacgctcgaaatggtcacggactccgagcgcgac
tacttgtggaatacctatgcgagcgaccggcgtgcgcgcctgaacctcggtatccgccga
cgcctcgcgccgctgatggagcgcgaccgccgccgcatcgagctgatcaattcgctgctg
ctgtcgatgccgggcacgcccgtcatctactacggcgacgaactcggcatgggcgacaac
attcacctcggcgaccgcgacggcgtgcgcacaccgatgcaatggtcgtcggacagaaac
ggcggcttctcgcgcgccgatcccgaacaactggtgctgccgcccgtgatgggctcgctg
tatggcttcgatgccgtgaacgtcgaagcgcaaagccgcgatccgcactcgctgctcaac
tggacgcggcgcatgctcgcgacgcgccgctcgaagcacacgttcgggcgcggcacgatc
cgcttcctgaagccgagcaaccgcaagattctcgcgtatctgcgcgaactgcccggccag
ccgcccattctgtgcgtagcgaacctgtcgcgcgcgccgcaggcggtcgaactcgatctg
tccgaattcaacggtgcagtgcccatcgaaatgacggcggattcggtgttccccgcgatc
gggcaactgacgtatctgctgacgttcccgccgtacggcttcctgtggttccttctttgc
gaaggcggcggccgtccgacatggagccaggcgccgtccgaaccactgcccgatttcgtg
accatcgtgatccgcgaaggtcaggcgggcccgacgccagaaaacgtgcggctgctcgaa
tcggaagtgttgccgtcgtggctgggacgccgcagatggtatgcgtcgaaggatcagaag
ctgcatgccgtgcgcctcgccgcgctcacgacgatccccgaagcgggcttcgcgttcacg
gagatcgaagcggatgtcggcaaccacaccgagcgttacgtgctgccgctcgcgatcacg
tggggcgccgacacgaccacgccgctcttcatgcaactggcgctggcgcgcgtgcgccgc
gggcgcaacgtcggccatctgacggatgcgttcgcgttgccgcagttcgcgtacggcacg
ctgcgcaaactgcgcgagcgcgccgccgtggcgactttccagaagagcacgatccatttc
attccgaccgaccgtttcgccgacctcgatcttggcgatgcgccggaaatccgctggctc
gccgccgagcaaagcaacagctcgctcgtgatcgccgacaagatcgtcttgaagctcgtg
cggcgcctgttgaagggcatgcacccggaagcggaaatgagccgctatctaacgcagctc
ggctatgcgaacacggcgccgctgtatggcgaagtggtgcgcgtcgatccggagaacgtg
ccgcatacgctgtgtatcctgcaaggcttcgtcgacaaccagggcgacgcgtggaactgg
gcgctcgacacgctgcgccgttcgatcgacgaactcgcgctcgccgtcgatggcgccaac
aacgagaaccaggcgaaccaggaccgcgtgaacgaggaagaggcgacggaaggctacgcg
tcgtacatgggcatcatcggcaagcggctcggcgagttgcacgtcgcgctcgcgacgcct
tcggacaatccggcattcgatcccgaactcgctgacagcaagcaggtgcaggcgtggatc
gacggcacgcagaaattgcttgccagcgcgctcgagctgctcgagaagaacgtcgatcag
ctcggcgaagatgccgcactgctcggccgcagcgttctcgaccgcaaggacaagctggtc
gaagcggtgtcgaagctcgtgaagcccgacgcgcatgcgctgcgcacgcgcattcacggc
gacttccatctcggccaggtgctcgtggcgcaaggcgacgccttcctgatcgacttcgaa
ggcgagccggcgcgcgaactcgaagagcgccgcgcgaagtccagcccgctgcgcgacgtc
gcggggctgttgcgttcgctgtcgtacgcgagcgccgccgcgcaatcgacgatggaagcc
gcgccgcagatgacggccgaccgcaagcgcgcgctgttcgagcgcttccgggccgccgct
gccgaggcgttcctcaccgagtaccgcgcggcaacgcaagccgcgtcgcaacggctcgtc
gcgccggagcacgaacaggcgttgctcgatctgttcctgatcgagaaagccgcctatgaa
atccgctacgaagcggccaaccggccggcatggctcggcttgccggtgcgcggcctcgcc
gcgctgacgagccgcctgctgggcgacacgggcgcagcgccgcattcgccggcggctgcc
tcggcgcctcccgcagcatcagagggcgattatgagtga

DBGET integrated database retrieval system