KEGG   Phyllobacterium zundukense: BLM14_01395Help
Entry
BLM14_01395       CDS       T05167                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pht  Phyllobacterium zundukense
Pathway
pht03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pht00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BLM14_01395
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pht03400]
    BLM14_01395
Enzymes [BR:pht01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BLM14_01395
DNA repair and recombination proteins [BR:pht03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BLM14_01395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ATU90466
UniProt: A0A2N9W0Y4
LinkDB All DBs
Position
complement(286953..289499)
Genome map
AA seq 848 aa AA seqDB search
MVALETYRKKRDFKTTSEPKGRKARKTGNSFVIQKHDARRLHYDFRLEMDGVLKSWAVTR
GPSLVPGEKRLAVHVEDHPLEYGDFEGTIPKGEYGGGTVIIWDRGTWAPVHDPDRGYAKG
HMEFELHGKKLSGRWHLVRMQGKPREKHENWLLIKGEDEAARSERDPDILEEKPKSVKTG
REIAEVAGEDPGWSSKTGKIDKQAVKAKPSKKPVVADEATVPDPSSVKGAKKTRLPSFVE
PALAALAPKPPTGERWIHEIKFDGYRLQVRIEAGRVKLLTRSGLDWTKKFGKQIVAAFQD
LPVGTALIDGELVVETAAGASDFSALQADLSADRTDRFVFYIFDLLYLDGYNLQGLSLVE
RKTMLQELVSGASTLIRYSEHFEGNGALILDHACRLSLEGIVSKLRDAPYRPGRGKSWVK
SKCSERQECVIAGYVPSTTSRKAIGSLVMGVYNGKKLEHVGRVGTGYSASLAEDLYRRLE
RIRVQESPFAERLSADAARQVRFTKPELVADVEFRSWTADGNLRHAAFRGLREDKDPTEV
VREAARPAAPLKPEGHSVKLTHPDRIYWPEQGVTKEGLADYYTDVWKYVSPFVVGRPLAL
LRSPEGITGQSFFQKHAWKGLNPNIALVKDPKDKDGEPLISVNDLDGLIGLVQSAVLEIH
PWGSTIADWEHPDMIIMDLDPGDDVPWTKVIEAAQETRQRLEQAGLKAFLKTSGGKGLHV
VVPLKPKAAWPEVKAFTKAIADSMASDSPDLYVSTITKSKRKGKILIDYLRNQRGATAVA
PYSTRARPGAAVSMPLAWDELNPGIGPNYFTVLNTPIRVSSYKTDPWADFRAAAAPIEKP
KAPRKKST
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgcgcttgaaacctaccgcaagaaacgcgatttcaagacgacatccgaaccgaag
ggccgcaaggcccgcaagaccggaaacagcttcgtcattcaaaagcacgatgcacgacgg
ctgcattatgatttccggctcgagatggatggcgtcctgaaaagttgggccgtgacccgc
ggccccagtctcgttccgggtgaaaagcggctggctgtccatgtcgaagatcacccgctc
gaatatggtgactttgaaggaacgatacccaagggggaatatggcggcggcaccgtcatc
atctgggatcgcggtacatgggctccagtccatgatcccgaccggggctatgcgaaaggc
cacatggaattcgagcttcatggcaagaagctctccgggcgatggcacctggtgcgcatg
caaggcaagccgcgcgaaaaacatgaaaactggctgctgatcaagggtgaggacgaagct
gcgcgctcggaacgcgatcccgatatccttgaggaaaagccgaaatccgtaaaaaccggc
cgtgagattgccgaagtggccggtgaagacccgggatggtcgtcgaagaccggcaagatc
gacaagcaggccgtaaaggcaaagccttcaaaaaagcccgtcgtggcggatgaagccacc
gtccccgatccttccagcgtaaagggagcgaagaagactcgcctcccctccttcgtcgaa
ccggcattggctgcactcgcgccaaaaccgcccacaggcgagcgttggatccacgagata
aagttcgatggctatcgcctgcaggtgcggattgaagctggccgcgtcaagctccttacc
cgcagcggtctcgactggacgaaaaagtttggcaagcagatagtggcggcgtttcaggac
ctgcccgttggtacggcactcatcgatggtgaactggtggtggaaaccgcggctggcgcc
tcggatttttccgccctgcaggccgatctcagcgcagaccggacagaccgcttcgtcttt
tatattttcgaccttctctatctcgacggctataatttgcagggcctgtcgctggtcgaa
cgcaagaccatgctgcaagagcttgtcagcggtgcatcgacgctcatccgctacagcgag
catttcgagggaaatggtgcgctcattcttgaccatgcctgccgtctcagcctcgaaggc
atcgtatcgaaactgcgcgatgccccctatcgccccggtcgcggcaagagctgggtcaaa
tccaaatgttcagaacgccaggaatgcgtcattgcgggctacgtgccgtccacgacttcg
cgcaaggccataggctcgctggtcatgggcgtctataacggcaagaagctggaacatgtc
ggccgtgtcggcacgggctacagcgcatccctcgccgaagacctataccgcaggcttgaa
cgcattcgcgtgcaggaaagcccctttgccgagcgtctgagcgccgatgccgccagacag
gtacgctttacgaagccggagctcgtagcagatgtggaattccgcagctggactgcggac
gggaaccttcggcatgccgcctttcgcggcttgcgcgaagataaagatccaactgaagtc
gtccgagaagcagcaagaccggccgctccactcaaacccgaggggcactccgtgaaactc
actcatcccgatcgcatctattggcccgaacagggtgtcaccaaggaaggtctggcggac
tattacacggacgtctggaagtatgtctcgcccttcgtcgttggtcgcccgctggccctc
ctgcgaagtcccgaaggcatcaccggccaatccttcttccagaaacacgcctggaagggc
ctcaatccgaacatcgccctcgtgaaggaccccaaggacaaggatggcgaaccgctgatc
agcgtcaatgatctcgatggcctgatcggtctggtgcaatccgccgttctcgaaattcac
ccgtggggctcgaccattgccgactgggaacatccggacatgatcatcatggaccttgat
cctggcgatgacgtaccttggacaaaagtgatcgaagcggcacaggaaacacgtcagcgg
cttgaacaggccggcctcaaggcctttctcaagacctcgggaggcaagggccttcatgtg
gttgtgccactgaaacccaaggccgcgtggccggaggtgaaggctttcaccaaggccatc
gccgattccatggcgtcggacagccccgatctctacgtctcgacgatcaccaagtcgaag
cgcaaaggcaagatcctcatcgattatctgcgtaaccagagaggcgccaccgcagtcgca
ccatactctacccgtgcgcgtccaggtgcggcggtatcaatgcctctggcatgggatgaa
ctgaatcccggcataggacccaactattttaccgtattgaataccccgatccgggtttcc
tcatacaaaaccgatccctgggctgattttcgtgccgccgccgccccgatcgaaaaaccg
aaggcgccgcgcaagaagagcacctaa

DBGET integrated database retrieval system