KEGG   Phyllobacterium zundukense: BLM14_03790Help
Entry
BLM14_03790       CDS       T05167                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pht  Phyllobacterium zundukense
Pathway
pht00240  Pyrimidine metabolism
pht01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pht00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BLM14_03790
Enzymes [BR:pht01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BLM14_03790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: ATU90854
UniProt: A0A2N9VZH5
LinkDB All DBs
Position
782765..783358
Genome map
AA seq 197 aa AA seqDB search
MAKLCFSYSAMNAGKSTLLLQASYNYQERGMRTMLFTAAHYAENGIGRITSRLGVSAEAE
LYRESDMLFERIAAAHTQSPLSCVFVDEAQFLTKDQVWQLARVADRLNVPVICFGLRTDF
QGKLFPGSSELLAIADTLREIRTICHCGAKATMVVRHDPQGKALIEGDQVAIEKSVYVSL
CRKHWEEETGRVKPTDS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctgtttcagctactcggcaatgaatgccggaaaatccacgctgctcctg
caggcttcctacaattatcaggagcgcggcatgcggacgatgctgtttacagccgcgcat
tatgccgaaaacgggatcggaagaatcacctcgcgacttggtgtcagcgccgaggccgaa
ctttatcgcgaaagcgacatgctgttcgagcgaatcgctgctgctcacacgcaaagcccg
ctcagttgcgtgtttgtcgacgaagcgcagttcctgaccaaagaccaggtctggcagctc
gcgcgcgtcgcggaccgtctcaatgttccggtcatctgtttcgggctgcgtaccgatttt
cagggcaagcttttccccggttcttcggagctcctggccattgccgatacattgcgtgaa
atccgcaccatctgccattgcggtgccaaggcaaccatggttgtccggcatgatccgcag
ggcaaggcattgatcgaaggtgaccaggtggcgatcgaaaagtcggtctatgtttccctc
tgccgcaagcactgggaagaggagacggggcgcgtcaagccaaccgactcttaa

DBGET integrated database retrieval system