KEGG   Phyllobacterium zundukense: BLM14_04855Help
Entry
BLM14_04855       CDS       T05167                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pht  Phyllobacterium zundukense
Pathway
pht00473  D-Alanine metabolism
pht00550  Peptidoglycan biosynthesis
pht01100  Metabolic pathways
pht01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pht00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BLM14_04855
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLM14_04855
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BLM14_04855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pht01011]
    BLM14_04855
Enzymes [BR:pht01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BLM14_04855
Peptidoglycan biosynthesis and degradation proteins [BR:pht01011]
 Precursor biosynthesis
  Amino acid ligase
   BLM14_04855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 GARS_A SIMPL ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ATU91034
UniProt: A0A2N9W2N3
LinkDB All DBs
Position
1015916..1016842
Genome map
AA seq 308 aa AA seqDB search
MAKKHVAMLMGGFSSERPVSLSSGNACADALEAEGFSVTRVDVARNIASVLLELKPDVAF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMNKEQAKIVAKAAGVPVAEAKTMNR
HAFTSSHPMKPPYVVKPVSEGSSFGVVIVKEDQSHPPQVITSNDWKYGDTVMVERYIHGR
ELTCAVMGDVAIGVCEIIPVGHQFYDYDSKYVAGGSNHVVPAKISLKIYQKIQTLALKAH
QAIGCKGISRSDFRYDDRFSEDGELIWLEVNTQPGMTPTSLVPDIAKAAGHTFGELLSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaagcatgttgcgatgctgatgggtgggttttcatcggaacgtccggtgagc
ctttcctccggcaatgcttgcgccgatgccttggaggcggagggcttctctgtgacgcgc
gttgatgttgcccgtaacattgccagtgttctgcttgagctgaaacccgatgtggcattc
aacgcattgcacggccctttcggcgaggatggcacgattcagggcatcctcgaatatctc
gaaattccctatacccattccggtgtgctggcatcggctcttgccatgaacaaggagcag
gcgaagatcgtcgccaaggcggctggtgttcctgtggcagaagcgaagaccatgaaccgg
catgccttcacctcatcccatccgatgaagccgccttatgtggtcaagccggtaagcgag
gggtcgagcttcggtgtcgtcatcgtcaaggaagaccagtcgcatcccccgcaggtcatt
acctcgaacgattggaaatatggcgataccgtcatggtcgagcgctacatccacgggcgg
gaattgacatgcgccgtgatgggtgatgtcgccatcggggtgtgtgaaatcatccccgta
gggcaccagttctacgattatgattcaaaatatgttgcaggcggatcaaatcatgtggtt
cccgctaaaatttcactaaaaatttaccaaaaaatacaaacactggcactcaaggcgcat
caggcaattggatgtaaagggattagccggtcggacttccgttacgacgaccgtttttcc
gaggatggcgagcttatctggctggaagttaacacccagccgggcatgactcccacttct
ctcgtgcctgatatcgccaaagctgcggggcataccttcggtgaattgttgagttggatg
gtggaggacgcatcgtgtttgcgttga

DBGET integrated database retrieval system