KEGG   Phyllobacterium zundukense: BLM14_08520Help
Entry
BLM14_08520       CDS       T05167                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
pht  Phyllobacterium zundukense
Pathway
pht00010  Glycolysis / Gluconeogenesis
pht00620  Pyruvate metabolism
pht01100  Metabolic pathways
pht01110  Biosynthesis of secondary metabolites
pht01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLM14_08520
   00620 Pyruvate metabolism
    BLM14_08520
Enzymes [BR:pht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BLM14_08520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ATU91666
UniProt: A0A2N9W1E1
LinkDB All DBs
Position
1744204..1745721
Genome map
AA seq 505 aa AA seqDB search
MNKVEFNRTIKPNFKKRYGNFIGGKFVEPKSGRYFENTSPVNGQVLCEIARSDASDVDAA
LDAAHAAKEAWGRTSPAERSVILNKIAQVMEDNLTLLAQAETWDNGKPIRETTAADLPLA
IDHFRYFAGVIRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALAA
GNCVVLKPAEQTPASILVLAELIGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVTAEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALIHESIYDKFMEKALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYMDIGRQ
EGAEVLTGGERNVLAGDLAGGYYVKPTVFKGHNRMRIFQEEIFGPVVSVTTFKDNDEALS
IANDTLYGLGAGIWSRDANTCYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRENH
LKMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtagaattcaaccgcactatcaaacccaacttcaaaaagcgctatggcaat
ttcatcggcggaaagttcgtcgagccgaagtccggccgctattttgaaaatacatcgcct
gtgaacggccaggttctttgtgaaatcgccagatccgatgcgagcgatgtcgatgcggcg
cttgacgctgctcatgccgccaaggaagcctggggccgcacaagcccggcggaacgcagc
gtcatccttaacaagatcgcgcaggtcatggaagacaacctgacgctgctggctcaggcc
gaaacctgggacaatggcaagcctatacgtgaaacgacagctgccgacttgccccttgcg
attgatcactttcgctatttcgctggcgtaatccgcgctcaggaaggtggaatctccgag
atcgaccacgataccgtcgcttaccattttcacgagccgcttggtgtcgtcggccagatt
attccctggaatttccccattctgatggccgtgtggaaactggctccagcactggctgca
ggaaactgcgtcgttctgaaaccggccgaacagacgccggcctcaattctcgttctggca
gaactgattggtgatcttttgccgcccggcgttttgaacatcgtcaacggctttggactg
gaagccgggaagccgcttgcatcaagcccacgaattgccaagattgcttttaccggagaa
acgaccactggccgcctgatcatgcaatatgcaagccagaacctcatcccggtaacactc
gaactcggcggcaagtcgccgaatatattcttcaaggacgtaaccgccgaggatgacgat
ttcttcgacaaggcaatcgaaggatttgtcatgttcgcgctcaaccaaggtgaagtctgt
acctgcccgagccgcgcgctcattcatgaatccatctacgacaagttcatggaaaaggcg
ctaaagcgtgtcgaagcgattgtgcagggagacccgctcgatcccgcaacgatgatcggt
gcgcaggcatccagcgaacagctcgagaagattctctcctacatggacattggcaggcag
gaaggtgccgaggtgctcacaggcggcgagcgcaatgttctggccggcgatctggcgggc
ggatattacgtcaagccgaccgtattcaaagggcacaaccgcatgcgaatcttccaggaa
gagatcttcggccccgtggtctcggtgacaacctttaaggacaatgacgaggcgctatcg
atcgccaacgacacactctacggattgggcgcgggcatttggagtcgtgacgccaacacg
tgttaccgctttggccgggctattcaggctgggcgtgtctggaccaactgctaccatgcc
tatccagctcacgctgcatttggtggttacaagcagtctggtatcggtcgtgaaaatcat
ctgaagatgctggatcattatcagcagaccaagaatatgcttgtcagctacagccctaag
aagctcggctttttctga

DBGET integrated database retrieval system