KEGG   Phyllobacterium zundukense: BLM14_09560Help
Entry
BLM14_09560       CDS       T05167                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pht  Phyllobacterium zundukense
Brite
KEGG Orthology (KO) [BR:pht00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pht03012]
    BLM14_09560
   03029 Mitochondrial biogenesis [BR:pht03029]
    BLM14_09560
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pht04147]
    BLM14_09560
Translation factors [BR:pht03012]
 Eukaryotic Type
  Elongation factors
   BLM14_09560
 Prokaryotic Type
   BLM14_09560
Mitochondrial biogenesis [BR:pht03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BLM14_09560
Exosome [BR:pht04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BLM14_09560
  Exosomal proteins of breast cancer cells
   BLM14_09560
  Exosomal proteins of colorectal cancer cells
   BLM14_09560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ATU91842
UniProt: A0A2N9W4K8
LinkDB All DBs
Position
complement(1929835..1931010)
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKAYDQIDAAPEEKARGITIST
AHVEYETAARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSKYDFPGDDIPIVKGSALAALEDSNKE
IGEDAVRALMAEVDKYIPTPERPVDLPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIIGIKPTSKTTVTGVEMFRKLLDQGQAGDNIGALLRGVDREGVERGQILAKPGSVKPHT
KFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNIAVDVTL
IVPIAMEEKLRFAIREGGRTVGAGIVSSIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctaagagcaagtttgaacgtaacaagccgcacgtcaacattggcacgattggtcac
gttgaccatggcaagacgtcgttgacggcagcgattacgaagtattttggagagtacaag
gcgtacgatcagatcgacgcagcgccggaagaaaaggcgcgcggcatcacgatctcgacg
gcgcacgttgaatatgagacggcggcgcgccactatgcgcacgtcgattgccccggccac
gccgactatgtgaagaacatgatcaccggtgcggcacagatggacggcgcgatcctggtt
gtgtcggctgccgacggcccgatgccgcagacgcgcgagcacattcttctggcccgtcag
gttggcgttccggcgattgtggtgttcctgaacaaggtcgaccaggttgacgatgccgag
ctgctcgaactggttgagctggaagtacgcgagcttctgtcgaagtacgacttcccgggc
gacgacattccgatcgtcaagggttcggctttggctgcgctggaagactccaacaaggaa
atcggcgaagacgcggtacgcgcgctgatggcggaagtcgacaagtacattccgacgcca
gagcgtccggttgacctgccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgtggtacggttgtgacgggccgcgttgagcgcgggatcgtcaaggtcggcgaagaagtc
gagatcatcggcatcaagccgacgtcgaagacgacggtgaccggcgttgaaatgttccgc
aagctgctcgatcagggccaggctggcgacaacatcggtgccttgcttcgcggtgttgac
cgtgaaggcgtcgagcgcggccagatccttgccaagccaggttcggtcaagccgcacacc
aagttcaaggcagaagcctatatcctgacgaaggatgaaggtggccgtcatacgccattc
ttcaccaactaccgtccgcagttctacttccgcacgaccgacgtgacgggtgtagtgacg
ctgccggaaggcacggaaatggtcatgcccggcgacaacatcgcagtcgatgtgacgctg
atcgtgccgatcgcgatggaagagaagctgcgcttcgctatccgtgaaggtggccgcacc
gtcggtgcaggcatcgtatcgtcgatcattgagtaa

DBGET integrated database retrieval system