KEGG   Phyllobacterium zundukense: BLM14_17710Help
Entry
BLM14_17710       CDS       T05167                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pht  Phyllobacterium zundukense
Pathway
pht00564  Glycerophospholipid metabolism
pht01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pht00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BLM14_17710
Enzymes [BR:pht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BLM14_17710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 STPPase_N NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ATU93239
UniProt: A0A2N9VTJ2
LinkDB All DBs
Position
complement(3597151..3598692)
Genome map
AA seq 513 aa AA seqDB search
MGLPGLAEQIYDIFVIGGGINGCGIARDAVGRGYSVFLAEMNDLASGTSSGSTKLIHGGL
RYLEYYEFRLVRESLMEREVLWANAPHIIWPMRFVLPHHAGLRPAWLLRLGLFLYDHIGG
RKKLPATKTLDMTRDPAAKPLKSLYTKAFEYSDCWVNDARFVALNARDAADRGAVIRTRT
KVISARRDANAWTLILQDGLTGATEEVRSRLVVNAAGPWVDEVLTGVVGSNNAHNVRLVQ
GSHIVVKKKFDDPRAYFFQNTDGRIIFAIPYEQDFTLIGTTDQDYHGNPAEVKITDAEID
YLCAAASEYFVEPVKREHVVWTYSGVRPLYDDGASKAQEATRDYVLKADAPEGQAPLLNI
FGGKITTYRRLSEHMLEKIEDQLGKRGKPWTASGTLPGGDFAATAFDAELQKLKADYPFL
EARHAHRLFRLYGTKARVLLGKAASIDDLGKHFGSDLYEAEVRYQIEHEWAVTAQDVLWR
RTKKGLHLTADEAVALDRFMEDAVDRRRKLAAE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggattgccgggtttggctgaacagatctacgacatcttcgttatcggtggcggcatc
aatggatgcggcatcgcacgtgatgccgttggccgtggctattcggtgttccttgccgag
atgaacgatcttgccagcggcacctcttccggttcgaccaagctgatccatggcgggctg
cgctatctcgaatattacgaattccgcctggtgcgcgaatcgctgatggagcgcgaagtg
ctgtgggccaatgcaccgcatatcatctggccgatgcgtttcgtcctgccgcatcatgcg
ggcctgcgtccggcctggctcctgcggctcggtctcttcctctatgaccacatcggcgga
cgcaagaaactcccggcaacgaagacgctcgacatgacccgcgatccggctgccaagccg
ctgaagtcgctctatacgaaggccttcgaatattccgattgctgggtcaacgatgcgcgc
ttcgtcgcgctgaatgcccgcgatgcggcagaccgcggcgcggtcatccgcacccgcacc
aaggtcatcagcgcccgccgcgacgccaatgcctggacgctgatcctgcaggatggcctg
accggtgccaccgaggaagtccgatcacgcctcgtggtcaatgccgctggtccctgggtg
gatgaagtgctgaccggcgtggtcggtagcaacaacgcgcataatgtgcgcctcgttcag
ggcagccatatcgtggtgaagaagaagttcgacgatccacgtgcgtacttcttccagaac
accgacggccgcattattttcgccattccctatgagcaggatttcaccctgatcggcacc
accgatcaggattatcacggcaatccagcagaggtgaaaatcaccgatgccgagattgac
tatctttgtgcggcggccagcgagtatttcgtcgagccggtcaagcgtgagcacgttgtc
tggacctattcgggcgtgcgtccgctttatgacgatggggcctcgaaagcgcaggaagcc
acgcgcgattacgtgctgaaggccgacgcgccggaaggccaggcgccgctgctgaatatt
ttcggcggcaagatcaccacctaccggcgcctgtccgagcacatgctggaaaagatcgag
gaccagcttggcaaacgcggcaagccgtggaccgccagcggtacgctgccgggcggtgat
ttcgccgcgactgccttcgatgcagaattgcaaaaattgaaagcggactacccgtttctc
gaggcacgccatgcgcaccgcctcttccggctttacggcaccaaggcgcgcgtccttttg
ggcaaggcggcgtcgatcgacgatctcggcaagcatttcggttccgatctctacgaggcc
gaagtgcgctaccagatcgaacatgaatgggcggtgacagcgcaggacgtgttgtggcgc
cgcaccaagaagggtttgcatttgaccgctgacgaggcagtcgcacttgatcgcttcatg
gaagatgcggtcgaccggcggcgcaagcttgcggccgaatag

DBGET integrated database retrieval system