KEGG   Phyllobacterium zundukense: BLM14_19325Help
Entry
BLM14_19325       CDS       T05167                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pht  Phyllobacterium zundukense
Pathway
pht00020  Citrate cycle (TCA cycle)
pht00190  Oxidative phosphorylation
pht00650  Butanoate metabolism
pht01100  Metabolic pathways
pht01110  Biosynthesis of secondary metabolites
pht01120  Microbial metabolism in diverse environments
pht01130  Biosynthesis of antibiotics
pht01200  Carbon metabolism
Module
pht_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pht_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pht_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLM14_19325
   00650 Butanoate metabolism
    BLM14_19325
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BLM14_19325
Enzymes [BR:pht01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BLM14_19325
    1.3.5.4  fumarate reductase (quinol)
     BLM14_19325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 DAO Thi4 FAD_binding_3 FAD_oxidored HI0933_like
Motif
Other DBs
NCBI-ProteinID: ATU93520
UniProt: A0A2N9VWS7
LinkDB All DBs
Position
3921346..3923178
Genome map
AA seq 610 aa AA seqDB search
MAPTEKIGGKAYTFVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVAA
QGGIAASLSNMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPAAVYELEHYGVPFSRT
EAGKIYQRPFGGHMMNYGDGPPVQRTCAAADRTGHAILHTLYGQSLRNNAQFFIEYFALD
LIQDEDGTITGVVAWNLDDGTIHRFAAKMVVMATGGYGRSYFSATSAHTCTGDGGGMVAR
AGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDV
VSRCMTLEIREGRGVGKNKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDLTKEPIPV
LPTVHYNMGGIPTNYWGEALNPTPDNPDRIQPGLMAVGEAGCASVHGANRLGSNSLIDLV
VFGRAAAIRAGEVIDRNAKIPDINEASVTKIMDRFDRLRHANGSTPTAALREKMQRTMQE
DAAVFRTSESLKSGVQRMEKIWSELPDVKVTDRSMIWNSDLVETLELENLMANALTTVVA
AEARKESRGAHAHEDFPNRDDVNWRKHSLAWLTPDGEVTLGYRPVHLDPLVKEEDGGISL
AKIAPKARVY
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaacagaaaaaatcggcggcaaggcctatacattcgtcgaccacaagttcgat
gtggtcgtggtcggggccggaggcgctggcctgcgggcaacgctcggcatggccgagcag
ggcctgaagaccgcctgtatcaccaaggtcttcccgacccgctcgcacacggttgcggcg
cagggcggcattgccgcctcgctcagcaatatggggccggattcctggcaatggcacatg
tatgacaccgtcaagggttccgactggctcggagacaccgacgcgatggaatatctggcg
cgcgaagcgccggcagcggtctatgagcttgagcattatggcgtgccgttctcccgtacc
gaagcaggcaaaatctaccagcgcccctttggcgggcacatgatgaattacggcgatggt
ccgccggtgcagcgcacctgcgccgcggccgaccgcaccggccacgccatcctgcacacg
ctctatggccagtccttgcgcaacaatgcgcagttcttcatcgaatatttcgcgctcgat
ctcatccaggatgaggatggcacgatcaccggcgttgtcgcctggaatctcgatgatggc
acgattcatcgttttgccgccaagatggtggtcatggctacgggcggctacgggcgctcc
tatttctccgcgacctcggcgcatacctgtacaggtgacggcggcggcatggtcgcccgc
gctgggctgccattgcaggacatggagttcgtgcagtttcatccgaccggcatctacggc
gccggctgtctgatcaccgaaggcgcgcgcggcgagggcggctatctcgtcaattccgaa
ggcgagcgcttcatggagcgctatgcgccctccgccaaggatctggcatcgcgcgacgtg
gtttcgcgttgcatgacgctggaaatccgcgaaggtcgcggtgtcggcaagaacaaggat
catatcttcctgcatctggatcacctcgatccggcggtcctgcatgaacgcctgcccggc
atttcggaatcggcgaagattttcgccggcgttgacctcacgaaggagccgattccggtc
ctcccgacggttcactacaatatgggcggcattccgaccaattactggggcgaggcgctc
aacccgacccccgacaatcccgaccgcatccagcctggtttgatggccgtgggtgaagcg
ggctgcgcctcggtgcacggggccaaccgtctaggctccaactcgctgatcgatcttgtc
gtgttcggtcgcgcagccgcgatccgcgctggcgaggtgattgatcgcaatgccaagatc
ccggatatcaacgaagcttcggtaacgaagatcatggatcgctttgatcgtcttcgtcat
gccaatggaagcacgcccacagctgccttgcgcgaaaagatgcagcggaccatgcaggaa
gatgcggccgtgttccgcacatcggaatcgctgaagtccggcgttcaacgcatggaaaag
atctggagcgagttgccggacgtcaaggtcaccgaccgttcgatgatctggaattccgac
ctggtggaaacgctggaactggaaaacctgatggccaacgccctgaccacggtcgttgcc
gccgaagcgcgcaaggaaagccgcggcgcccatgcgcatgaggatttccccaaccgcgat
gacgttaactggcgcaagcacagcctcgcctggctcaccccagacggcgaggttacgctc
ggttaccgtcctgtccaccttgacccgctggtcaaggaggaggatgggggcatcagcctc
gccaagatcgcgccgaaagcgcgtgtgtattga

DBGET integrated database retrieval system