KEGG   Phyllobacterium zundukense: BLM14_21215Help
Entry
BLM14_21215       CDS       T05167                                 

Definition
(GenBank) hypothetical protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
pht  Phyllobacterium zundukense
Pathway
pht00040  Pentose and glucuronate interconversions
pht00051  Fructose and mannose metabolism
pht01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BLM14_21215
   00051 Fructose and mannose metabolism
    BLM14_21215
Enzymes [BR:pht01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BLM14_21215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ATU94280
UniProt: A0A2N9VW98
LinkDB All DBs
Position
unnamed1:complement(364660..365640)
Genome map
AA seq 326 aa AA seqDB search
MKFATRLNSFASRPQADWPDLSGKPSVAQMVARAAKVDGLTDLDLNYPDHVAENPRELAR
KIEDMGLAINGFAMRYYTNPAFKIGAFTNPDAAVRREAIDLTKRGIDAARQAGSNLMTIW
LGQDGFDYAFQADYATLWQHEISGIREVCGHDPDCQISIEYKPNEPRSYSLMPDCATTLL
AIKEVGLPNLGVTLDFAHVLYADEQPAFAAALIARYSRLLGVHLNDGYAKRDDGLMVGAV
HTQQTIELLRQIRKDGYDGAIYFDTFPDMTGLDPVHECEVNIQTVKRMLDVVDRLEQDNR
LSGAIDRQDAVSAQSIIQEAMLGARA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattcgccacccgcctcaactcctttgcctcccggccacaggccgattggccagat
ctttccgggaagccgagtgtcgcgcagatggtcgctcgcgctgcaaaggtcgacggtttg
acggatctcgacctcaactatcccgaccacgtcgctgaaaacccacgagaattggcgagg
aagatcgaagatatgggtctggcgatcaatggttttgcgatgcgttactacaccaatccc
gctttcaagattggcgccttcaccaaccctgatgcagcggttcgccgtgaagccatcgac
ctcacgaagaggggcatcgacgcggcgcgtcaggccggcagcaatctgatgaccatctgg
ctcgggcaggatgggttcgactacgctttccaggccgactatgcgaccttgtggcaacac
gagatttcaggaattcgtgaagtttgtgggcatgatcccgattgccagatcagcatcgag
tacaagccgaacgagccgcgctcctacagcctgatgcccgactgcgccacgacgctgctg
gccatcaaggaagtcggtctccccaatcttggcgtgacgctcgacttcgctcacgtactc
tatgccgatgagcagccggccttcgcggcggcgctgatcgcccgctacagccggttgctc
ggcgtccatctcaacgacggttatgccaagcgcgacgatggcctgatggtcggcgccgtt
catacacagcagacgatcgaactgctgcgccagatccgcaaggacggttatgacggcgcg
atctatttcgacacatttccggatatgaccggtctcgatccggtccacgaatgcgaggtg
aacatccagaccgtcaagcgcatgcttgatgtcgtggaccgccttgagcaggacaatcgc
ctgtctggtgcgattgaccgtcaggatgccgtctccgcccagtccatcattcaagaagcg
atgcttggcgcgagggcttga

DBGET integrated database retrieval system