KEGG   Phyllobacterium zundukense: BLM14_23975Help
Entry
BLM14_23975       CDS       T05167                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pht  Phyllobacterium zundukense
Pathway
pht00630  Glyoxylate and dicarboxylate metabolism
pht01100  Metabolic pathways
pht01120  Microbial metabolism in diverse environments
pht01200  Carbon metabolism
Module
pht_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pht_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:pht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BLM14_23975
Enzymes [BR:pht01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BLM14_23975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N OMPdecase HMGL-like
Motif
Other DBs
NCBI-ProteinID: ATU94807
UniProt: A0A2N9VPI3
LinkDB All DBs
Position
unnamed3:complement(286300..287760)
Genome map
AA seq 486 aa AA seqDB search
MSNKSETVTGKDRYRSGVMEYKKMGYWEPDYEPKDTDIIALFRITPQDGVDPIEAAAAVA
GESSTATWTVVWTDRLTATEKYRAKAYRVDPVPNGEGQYFAYIAYDLDLFEPGSISNLTA
SIIGNVFGFKPLKALRLEDMRLPVAYVKTFQGPPTGIVVERERLDKFGRPLLGATVKPKL
GLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYCMEAVNKAQAATGEIKGS
YLNVTAATMEDMYERADFAKELGSNIVMIDLVIGYTAIQSMAKWARRNDMILHLHRAGHS
TYTRQKSHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPATTRGYYDICREDFNPMRLE
NGVFFDQHWASLNKMMPVASGGIHAGQMHQLLDLLGEDVVLQFGGGTIGHPMGIAAGATA
NRVALECMVLARNEGRDIVREGPEILRMAARNCQPLQQALEVWKDVSFNYTSTDSPDFVP
TATAAE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacaagtcggaaacggtcacaggaaaggaccgctacaggtccggtgtcatggaa
tacaagaagatgggctattgggagcctgattacgaaccgaaggacaccgacatcatcgcg
ctctttcgcatcacgccgcaggatggcgtggatcccatcgaagctgccgctgcggtggct
ggtgaatcgtctactgccacctggacggtcgtctggaccgaccgcctcaccgcgacagaa
aagtatcgcgccaaggcctaccgcgttgatccggttcccaatggtgagggccagtatttc
gcctacatcgcctacgatctcgatctgttcgagccgggctccatctcgaacctgaccgcg
tcgatcatcggcaacgtctttgggttcaagccgttgaaggcgctgcggctcgaggacatg
cggctgccagttgcctatgtcaaaaccttccagggtccgccgaccggcatcgtcgtcgag
cgcgaacgtctggacaaatttggccgtcccctgctcggcgcaacggtgaagccaaagctt
ggcctgtccggccgcaactacggtcgcgtggtctatgaagcgctgaaaggcggcctcgat
ttcaccaaggatgacgagaatatcaactcgcaacctttcatgcactggcgcgaacgcttc
ctctattgcatggaggccgtcaacaaggcgcaggccgcgaccggtgagatcaagggcagc
tacctcaacgtcaccgcggcgacgatggaggacatgtatgagcgagccgacttcgccaag
gaactgggctcgaacattgtgatgatcgatctggtgatcggctatacggcgatccagtcc
atggcgaaatgggcgcgccgcaatgacatgatcctgcatctgcatcgtgccggccattcc
acctatacacggcagaagtcgcatggcgtatcattccgcgtcatcgccaagtggatgcgc
cttgccggcgtcgatcatatccatgcaggcaccgtcgtcggcaagctcgagggcgatccc
gcgaccacacgcggctactacgacatctgccgcgaggatttcaacccgatgcggttggag
aacggcgtgttcttcgaccagcactgggcctctctcaacaagatgatgccggtggcgtcc
ggtggcatccatgccggccagatgcaccagcttctcgatcttttgggcgaagatgtcgtc
ctgcagttcggcggcggcaccattggccacccgatgggcattgccgccggtgccacggcc
aatcgcgttgcgctcgaatgcatggtgctcgcgcgcaatgagggccgcgatatcgtgcgg
gaaggccccgagatactgcggatggctgcgcgcaattgccagcctttgcagcaggcgctc
gaggtctggaaggacgtgtccttcaactacacctcaaccgactcgccggatttcgttccg
acggcaacagcagctgaatag

DBGET integrated database retrieval system