KEGG   Phyllobacterium zundukense: BLM14_26360Help
Entry
BLM14_26360       CDS       T05167                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pht  Phyllobacterium zundukense
Pathway
pht00440  Phosphonate and phosphinate metabolism
pht01100  Metabolic pathways
pht01120  Microbial metabolism in diverse environments
pht01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pht00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BLM14_26360
Enzymes [BR:pht01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BLM14_26360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: ATU95248
UniProt: A0A2N9VYV0
LinkDB All DBs
Position
unnamed2:261341..262213
Genome map
AA seq 290 aa AA seqDB search
MSKAKQLRDRMAERGLVHIMAAHSPLSAILAEEAGFDGLWASGFELSALYGLADMSLITM
TQHLDMLRAIAGQSSLPIVADIDTGYGNALNVIHAIREYEKAGTAAVVIEDKTFPKVTSL
AADGRQELLRIEEFQGKIEAAVSTRSDPDFLVIARTEALIAGLGEEEALKRGMAYAEAGA
DMVLIHSKKKDPAEIESFSRAWKGIVPLVIVPNAYPELNATRIRALGNIKMTIYGNYGIR
AATTAMQDAFRRIIADGGVQNVHKDIVPVEEIFRLQKMDEVKADEKRFLR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagcaaagcaactgcgtgaccgcatggccgaacgcggcctcgttcacatcatg
gcggcccacagcccgctgtccgccatcctcgccgaagaggccggcttcgacggtctctgg
gcttccggcttcgaactttcggcgctctacggacttgccgatatgagcctgatcacgatg
acccagcatctcgatatgctgcgggcgatcgccggtcagtcctcgctgccgatcgtcgcc
gatatcgatacgggctacggcaacgcattgaacgtgatccatgccatccgcgaatacgaa
aaggcgggcacggccgccgtcgtgatcgaggacaagacctttccgaaggtcaccagcctg
gccgccgatggccgccaggaactgctgcgcatcgaggaattccagggcaagatcgaagct
gcggtctccacccgcagcgatccggatttcctcgtcattgcccgcacggaagccctgatt
gcgggcctcggcgaagaggaagcgctgaagcgcggcatggcatatgccgaggccggcgcg
gacatggttctgatccactcgaaaaagaaggacccggccgagatcgagagtttttcccgc
gcctggaagggcatcgtcccgctcgtcattgttccgaacgcttatccggaactcaacgcc
acgcgtatccgcgcgctcggcaacatcaagatgacgatctacggcaattatggtatccgc
gccgcgacgactgcgatgcaggatgctttccggcggatcatcgccgatggcggcgtgcag
aacgtgcacaaggacatcgtgcccgtcgaagagatcttccggcttcagaagatggacgag
gtcaaggccgacgaaaagcggttcctgagatag

DBGET integrated database retrieval system