KEGG   Phyllobacterium zundukense: BLM14_28060Help
Entry
BLM14_28060       CDS       T05167                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
pht  Phyllobacterium zundukense
Pathway
pht00910  Nitrogen metabolism
pht02010  ABC transporters
Module
pht_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:pht00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BLM14_28060
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BLM14_28060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pht02000]
    BLM14_28060
Transporters [BR:pht02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BLM14_28060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ATU95785
UniProt: A0A2N9VUZ5
LinkDB All DBs
Position
unnamed4:complement(41419..42246)
Genome map
AA seq 275 aa AA seqDB search
MTTPKKTVARRALPQWLTSLTGHVVPPLITLAFLLVFWEIICSSPTASIPAPSRVVSETW
ELIAHPFYVGQGIDQGLFWHIFASLRRVALGYCLAAVVGIALGTLVGQSQWAMRGLDPIF
QVLRTVPPLAWLPLSLAAFKDGNPSAIFVIFITAIWPIIINTAVGIRNIPQDYLNVAKVL
RLNQFEYFTKIMIPAAAPYIFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAWNSSRI
SDIILALIYVGIVGYLLDRTIAFVAKAVTRNTASA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgaccactcctaaaaaaaccgttgcgcggcgggctcttccgcagtggcttacctctttg
acaggacatgtcgtgccgccgctcatcacgctggcatttttgctggtattctgggagatc
atctgttcgtcaccgacagcgagcattcccgccccttcgcgcgttgtttccgaaacctgg
gaattgatcgctcatccgttctatgtggggcagggcattgatcaaggccttttctggcac
attttcgccagcctcagacgcgtggcccttggctactgtcttgcggcggttgtcgggatt
gcgcttggaacattggttggtcaaagccaatgggccatgcgcggtcttgatccgatcttc
caggtgctgcgcacggtgccgccgctcgcgtggctgccgctgtccttggccgcattcaag
gacggcaatccgtcggcaatcttcgtgatcttcatcactgcgatatggccgatcataatc
aacacggcggtgggtatccgcaatattccgcaagactacctgaatgttgcgaaagtgctg
cggctcaaccagttcgagtattttaccaagatcatgatcccggccgcggcgccttatatt
ttcactggcctgcgcatcggtatcggcctgtcatggctggccatcgtcgctgctgaaatg
ctcatcggcggtgtcggcatcgggttcttcatctgggacgcctggaattcgtcgcgcatc
agcgacatcattctcgccctcatctacgtcggtatcgtcggttacttgctcgatcgcacc
atcgccttcgttgccaaagccgttacccgcaacaccgcaagcgcttaa

DBGET integrated database retrieval system