KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM033930Help
Entry
Phum_PHUM033930   CDS       T01223                                 

Definition
(RefSeq) smad, putative
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04068  FoxO signaling pathway
phu04144  Endocytosis
phu04350  TGF-beta signaling pathway
phu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    Phum_PHUM033930
   04068 FoxO signaling pathway
    Phum_PHUM033930
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Phum_PHUM033930
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    Phum_PHUM033930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 8232291
NCBI-ProteinID: XP_002423056
VectorBase: PHUM033930
UniProt: E0VAB2
LinkDB All DBs
AA seq 418 aa AA seqDB search
MLPFSPPIVKRLLGWKKGDCNDDKWCEKAVKSLVKKLKKSCGLEELEKAITTQNPNTKCV
TIPSSDVCAPPGHRKGLPHVIYCRLWRWPELQSHHELRALETCQYAFSLKREEVCVNPYH
YQRIENTDSSNLYPTTIQCGDLTPSIPENISFSSSASHMEVPLIHGYPVSPSELSHSPQA
SIDTPATTETPPPGYISEDTDHNDNISLSRLTPSPPIDAQPVLYCEPAFWCSISYYELNT
RVGETFHASQPSITVDGFTDPSNSERFCLGLLSNVNRNAVVEQTRRHIGKGVRLYYIGGE
VFAECLSDSSIFVQSPNCNQRYGWHPATVCCNLKIFNNQEFAALLSQSVSQGFEAVYQLT
RMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDRVLTQMGSPRLPCSSMS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctttttcaccaccaatagtaaaaaggttattaggatggaaaaaaggagattgt
aatgatgataaatggtgtgagaaagcagttaaaagtcttgttaaaaaattaaaaaaaagt
tgtggattagaagaacttgaaaaagcaatcacaacacaaaatccaaatacaaagtgtgtt
actatacccagttcggacgtatgtgctcctccaggacatcgcaaaggtttgccacatgtt
atttattgcagattatggcgttggcctgaacttcaatcacatcacgaattaagggcatta
gaaacttgccaatatgcattcagtttaaaaagggaagaggtttgcgttaatccttatcat
tatcagagaatcgaaaacacagattcgtcaaatttatatccaacaacgatccagtgtggc
gatttaactccttcaatacccgaaaatatttctttttcttcctcagcttcacatatggag
gttcccctcatacacggttacccagtgagtccgtcagaattaagtcatagtcctcaagct
agcattgatactccagcgacaacagaaacgcctcctccgggatatataagcgaagacacc
gatcacaacgacaatataagtttgtccaggttaacgccaagtccaccgatagacgcccaa
cctgttttatattgtgaacctgcattttggtgttcaatttcttattacgagttaaacacg
agagtaggtgaaacttttcacgcttctcaaccttccattacagtagatggttttacagat
cccagtaattcggaaagattttgtttaggtttgttatcaaacgtgaatcgaaatgcggtt
gtcgaacaaacgaggcgacatattggaaaaggggttcgactgtattacattgggggtgaa
gtttttgccgaatgtttgagcgattcttcaatatttgttcagagtccaaattgcaatcaa
agatacggttggcatcctgcgaccgtttgctgcaacttaaaaatattcaataatcaagaa
tttgccgctttgttatcacagagcgtttctcaaggtttcgaagctgtttatcaattgacg
agaatgtgcacgatacgaatgagtttcgtaaaaggatggggtgcggaatatcggaggcaa
accgtgacttcaacaccgtgttggatagaacttcatttaaacggtcctttacagtggttg
gacagagttttaactcaaatgggttcaccaagacttccttgcagttcaatgagttaa

DBGET integrated database retrieval system