KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM087850
Entry
Phum_PHUM087850   CDS       T01223                                 

Definition
(RefSeq) hypothetical protein
  KO
K16679  wengen
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04013  MAPK signaling pathway - fly
phu04214  Apoptosis - fly
phu04215  Apoptosis - multiple species
phu04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Phum_PHUM087850
   04391 Hippo signaling pathway - fly
    Phum_PHUM087850
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Phum_PHUM087850
   04215 Apoptosis - multiple species
    Phum_PHUM087850
SSDB
Motif
Pfam: TNFR_c6 DUF515 Inhibitor_I29 Sulfatase
Other DBs
NCBI-GeneID: 8231663
NCBI-ProteinID: XP_002423840
VectorBase: PHUM087850
UniProt: E0VCJ6
LinkDB
AA seq 367 aa
MLLPIIIFYCLVTFANGEICENNQFWSSVLERCENCSRCTNPDIVIRPCERYADTVCGPL
SELNIDWTWLKNHGSHSKKGKHGNNQKEMLDTFKENFDQIRQHELHMKEKQKRKHKKDSD
ENSEEIESGDIFIGDRYKLKAFEDGDKNAMRLLIKHGNSDQKFTDEIKSSNGKNHNRLED
DPLMMLKTWQKLLRPHFPDGKIHVNDDKVPDVLKENGKENDLYDPNHLKFDENGILIKNF
GFTKIEDNVKIEKLIDDIKFSEDFSTTEKFILDWQTVILGIAVSSCIIFFLVAAIYSIQH
AKHWKKLRNYFDADVEELRSWISSKNSDSGNVPPSGIYKTTTEVVSTGGTQCKYLERIIR
MNGWYSV
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgcttttaccaataataatattttattgtctggtgacatttgcaaatggtgaaatttgt
gaaaataatcaattttggtcttccgttttggaaaggtgtgaaaactgttcaagatgtaca
aatcccgacatagttatccgaccctgtgagaggtatgccgatacagtttgcggaccttta
tcagaattaaacattgattggacatggttaaaaaatcatggttctcattcgaaaaaagga
aaacatggcaacaatcaaaaagaaatgttggacactttcaaggaaaatttcgatcaaatt
cgacaacacgaattacacatgaaagaaaaacaaaagcgaaaacataaaaaagactcggat
gaaaacagcgaagaaattgaaagcggtgatattttcataggagatcgttataaattaaaa
gcttttgaagatggtgataaaaacgccatgagacttttaataaaacatggaaattctgat
caaaaatttacggatgaaatcaaatcgtcaaatggaaaaaatcataatcgtttagaagac
gatcctctcatgatgctaaaaacatggcaaaaacttttaagaccgcattttcccgatggt
aaaatacatgtaaacgacgataaagtaccggacgtgttaaaagaaaatggtaaagaaaac
gatttgtacgatccgaatcatttgaaatttgacgaaaatggaatattgataaaaaatttt
ggtttcaccaaaatcgaagataatgttaaaatagaaaaattaatagacgatataaaattt
tccgaagatttttcaacgacggaaaaattcatactcgattggcaaactgttatattgggt
attgccgtatcttcgtgcataatatttttcttagtcgcggccatttattcaatacaacat
gctaaacattggaaaaagttgagaaattattttgacgcagatgtcgaagaacttcggtct
tggatttcatcgaaaaattccgacagtggtaacgtaccaccttctggaatatataaaacg
acaacagaagttgtttcgacaggaggaacgcaatgtaaatacttagaaagaataataaga
atgaatggttggtattccgtataa

DBGET integrated database retrieval system