KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM122380
Entry
Phum_PHUM122380   CDS       T01223                                 

Definition
(RefSeq) Cyclin-dependent kinase inhibitor, putative
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    Phum_PHUM122380
SSDB
Motif
Pfam: CDI DUF3781
Other DBs
NCBI-GeneID: 8238360
NCBI-ProteinID: XP_002424234
VectorBase: PHUM122380
UniProt: E0VDP0
LinkDB
AA seq 157 aa
MRRVMRGGGHLDLSESEIRSPRDNNSLERIKKCLFGPIDHNECKLYVQQEMEKHREKASK
KWNFDFKTGKPMPSNEGNVYDWKILKENETVPQAYALTRLPYLSQHAADNCTVLKSSDLD
DTQNNPCSSSSITSAKKTPKCNKQTVITVKPVVGCIN
NT seq 474 nt   +upstreamnt  +downstreamnt
atgcggagagttatgcggggcggaggtcatttagatctcagcgaaagtgaaatacggtcc
ccacgcgataacaattcacttgaaagaataaaaaaatgtttattcggtccgattgatcac
aatgagtgtaagttatacgtgcagcaagaaatggaaaagcatcgagaaaaagcgtcgaaa
aaatggaactttgatttcaaaacaggtaaaccaatgccttcaaacgagggtaatgtttac
gattggaaaattttaaaagaaaatgaaactgttcctcaagcttatgctcttactagactc
ccatatttaagccagcacgctgctgacaactgcactgtactaaaatcttccgatttggat
gatactcaaaataatccatgttcaagctcatcgattacctcggctaaaaaaactcccaag
tgcaataagcaaactgtaatcactgttaaaccagttgtaggttgcataaattaa

DBGET integrated database retrieval system