KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM149090
Entry
Phum_PHUM149090   CDS       T01223                                 

Definition
(RefSeq) adenylate cyclase type, putative
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00230  Purine metabolism
phu01100  Metabolic pathways
phu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:phu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Phum_PHUM149090
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Phum_PHUM149090
Enzymes [BR:phu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Phum_PHUM149090
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 8236391
NCBI-ProteinID: XP_002424741
VectorBase: PHUM149090
UniProt: E0VF29
LinkDB
AA seq 1088 aa
MAVMEKKIDKNIENGNVEVNSGDKKKLLLLQLFSRAFNDDSLEKLYLSYSVKQKREGLHC
FILSSILYDIYYLSIPCDLNNFNWTLVGFLLSNLLLLIWCFFGMEKFLWLWPAIPYLSWI
ISISQLLMGLIFKNGDVTGHDNLGWTVLLDYLIYVLLPLRLRYCVLLSLVTCASYLVTVG
QLVKNNSHIIDQFSANFLLLLAANALGLATYLLSDKQQRRAFLETRQSLEMKMLVEEQSA
EQERLLLSVLPEHVAVKMRQDLGSALDSQFKKIYMSRHENVSILYADIVGFTAISSTYSA
SELVKILNELFARFDRLSERYHQLRIKILGDCYYCISGAPRERPDHAVLCVHMGLSMVKA
IKYVQQTCNSPVDMRVGIHTGAVLAGVLGQTQWQFDVYSKDVELANKMESSGKPGKVHIS
EKTLSFLNDEFEVEPAYGEKREEALRMAGMKTYFIVKVLKPFKPLKSNVNNGNIRDDSSQ
NYDSDYDGKDVDEDFEQRTSPQEEENQMLNNEKTNDGTEDFKNQLRKELINKGGLSTLSD
HTTWFTLSFKSNKKEKDFNHNKEAAATISLLGCPFVLLFISIAQFIILPRDELSFLSFTT
GFTILVIFSIIAVAELLPSIFFKEIVQCSLTASNILWVRRLLAAVAILVLASVNAVDMVS
LNFFPPEHVSCDISSSPLNCTAGGDTTTICLYPSYFSYFCVLVLVAASLPTQISHLIKIA
IFFIVVALHCSMNFFVISAALECEENFENDIYLVLKRSSMLVCVALALSFLARHVEKATR
VLFQWKTEVEEQREKASDIGRRNEVLVYNILPPHVAVHFLGNKKRQHEELYSQSYAEVGV
LFASMPNFSDFYSEESVNNQGLECLRFLNEVISDFDAILQLPRFQDIIKIKTIGSTYMAA
SGLNPSKVVKPDDSIQERWAHLALLVEFAFELKTALQGINEQSFNHFVLKMGINHGPITA
GVIGARKPHYDIWGNSVNVASRMESTGKAGCIQVTEETCKILQNFGYVFEQRGLVTVKGK
GQLMTYYLIGKEANEYKTSVKPDINTIVDDDDDDESTKMTTTIENDEGPSSELSETRLLN
SEIIHNDI
NT seq 3267 nt   +upstreamnt  +downstreamnt
atggctgtgatggaaaaaaaaattgataaaaatattgaaaatggtaacgtggaagtgaac
agtggtgataaaaaaaaattattattattacaattgtttagtagagctttcaatgacgat
tctttagaaaaattatatttatcatatagcgttaaacaaaaacgtgagggtcttcattgc
ttcatattatcatcaatactttacgatatttattatttatccattccttgtgatttaaat
aatttcaattggacactcgtcggttttttactatcaaatttattattattaatatggtgt
tttttcggaatggaaaaatttttatggctatggcctgccataccctatctatcgtggatt
atatcaatatcgcaacttttgatgggtttaatatttaaaaatggcgacgtcacgggtcac
gataatctcggatggaccgttttattggattatctcatttacgttcttttaccacttcgt
cttcggtattgcgttttgctcagtttggtcacttgtgcctcctaccttgtaacagttggt
caactcgtcaaaaataattctcatattatcgatcagtttagtgccaattttctgctactc
ttagccgccaacgcacttggattagcaacttatctcttatcggacaaacaacaaagaaga
gcttttttggaaactcgtcaatctctcgaaatgaaaatgttagtagaagaacaatccgcc
gaacaggaacgattattgctgtcggttttgccggagcacgtggctgttaaaatgcgacag
gatttaggttcagctcttgacagccaatttaaaaaaatttacatgagccgtcacgaaaat
gtcagtattctttacgcggatattgttggttttaccgccatttcttcaacttattcagca
tcggaattggttaaaatattaaatgaactttttgccagattcgatagattatccgagaga
tatcatcaactacgaataaaaatattaggtgattgttattattgtataagtggagcaccg
agagaaagaccggatcatgccgttttatgcgttcacatgggcctatcaatggtcaaagct
ataaaatacgttcaacaaacgtgtaattctccggtcgatatgagagttggaatacacaca
ggagccgtacttgcaggtgttttaggacaaactcaatggcaatttgatgtttattcgaaa
gatgtagaattagctaataaaatggaaagcagcggtaaacccggaaaagttcacatatcg
gaaaaaactttaagttttttaaatgatgaattcgaagttgaacctgcttatggtgaaaaa
agagaagaagctttaagaatggctggaatgaaaacttattttatcgttaaagtattaaaa
ccgtttaaaccgttaaaatcgaacgttaataatggaaatattcgagatgattcgtcgcaa
aattacgacagcgattacgatggaaaagacgtcgatgaagatttcgagcagagaacaagc
ccacaagaagaagaaaatcaaatgctcaataatgagaaaactaacgatggtacagaagat
tttaaaaatcaattaagaaaagagttgattaataaaggaggcttaagcactttatctgat
cacacgacttggttcacactttctttcaaatcgaataaaaaagaaaaagattttaatcat
aataaagaagcagcagcaacaatttcccttttgggttgtccgtttgttctactgtttata
tcgatagcacaatttattattttaccaagagacgaattaagttttttgtctttcacaact
ggatttaccattctcgtgatatttagtataattgcagtagccgaattgttaccttcgata
tttttcaaagagattgttcaatgcagtctcacggcaagtaatatactctgggttagacgt
ttgttggcagccgtggcaattttagtgttggcatcggtgaatgccgtcgatatggtgagt
ttgaatttttttcctcctgaacatgtgtcatgtgatatatcatcttctcctttaaattgc
acggcgggtggtgacacaaccaccatttgtttgtatccttcttatttttcatatttttgc
gtactcgtattggtcgcagcatctcttccaactcaaatttctcatctaataaaaattgca
atttttttcattgttgtcgctcttcattgttccatgaatttttttgtcatttctgcagca
ctcgaatgcgaagaaaatttcgaaaatgacatttatttagtattaaaaagaagttcgatg
ttggtttgcgttgctcttgcactttcatttttggcaagacatgttgaaaaagcgacaaga
gtattatttcaatggaagactgaagtcgaagaacagagagaaaaagcttcggatatcggt
agaagaaatgaagttttggtttataatattttaccaccgcatgtcgccgtccatttttta
ggaaataaaaaaagacaacacgaagaattatacagtcaaagttatgctgaagtcggtgta
ctttttgcttctatgcctaacttttcagatttttattctgaagaatccgtgaacaatcaa
ggacttgaatgtcttcgatttcttaacgaagtcatttcagattttgatgccattttacag
cttccaagatttcaagatataattaaaattaaaacaattggatccacttatatggccgca
agcggtctcaatccatcaaaagttgttaaacccgatgattcgatacaagaacgttgggct
catttagctttgcttgttgaattcgcatttgaattaaaaacagctttgcaaggaattaac
gaacaaagttttaatcatttcgtattaaaaatgggaatcaatcacggtccgataacagcc
ggtgttatcggagctcgaaaacctcattacgacatatggggaaattcggttaacgttgca
tcaagaatggaaagcactggaaaagcgggttgtatacaggttacggaagaaacttgtaaa
attctacaaaatttcggatacgttttcgaacaaagaggtttagtcacagttaagggaaaa
ggacaactaatgacttattacttaatcggaaaagaagcaaatgaatataaaacatcagtt
aaacccgatataaatacaattgttgatgatgatgatgatgatgaaagtacaaaaatgaca
acaacaatagaaaatgatgaaggcccttcatcggaattaagtgaaacgagacttttaaat
tccgaaataatacacaatgatatttaa

DBGET integrated database retrieval system